Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
A) A coding region was discovered in an intron of gene Fam172a by inference from peptide “KNPWPKVDAHSGVLLQYNGMLEMNYYTVLFGVSR”. B) The 5′ UTR of gene Abr could be refined by a novel ORF event inferred from a diagnostic peptide “KNPWPKVDAHSGVLLQYNGMLEMNYYTVLFGVSR”.
