Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
A) One predicted gene by AUGUSTUS was located in the forward strand of chr15:60320117-60350476. The newly discovered diagnostic peptide, “IGYNPDTVAFVSISGWSGDNMLEPSAKMLWFK”, was a proof to AUGUSTUS prediction. B) One predicted gene by AUGUSTUS was located in the forward strand of chrX:98899612-98969253. Four novel diagnostic peptides were found to support AUGUSTUS prediction.
