Table 37.1.
Flexi Vector compatible vectors for cell-free translation
| Name | Producta | Utility |
|---|---|---|
| pEU | Target | Expression screening, native protein |
| pEU-FV | Target | Expression screening |
| pEU-His-FV | His6-Target | Expression screening; His6 purification |
| pEU-HSBC | His6-Target | Expression screening; His6 purification |
| pEU-NGFP | GFP-target | Expression screening; detection |
| pEU-GFPC | Target-GFP | Expression screening; detection |
| pEU-Nb5R | Target-(cyt b5 reductase N-terminal anchor peptide)b | Spontaneous association of N-terminal anchor peptide to liposomes |
| pEU-Cb5 | Target-(cyt b5 C-terminal anchor peptide)c | Spontaneous association of C-terminal anchor peptide to liposomes |
a
The sequence of targets, domains, or tags found in the translated protein. For example, pEU-GFPC produces a target protein with GFP fused to the C-terminus, that is, target-GFP.
b
The N-terminal anchor peptide sequence is GAQLSTLGHMVLFPVWFLYSLLM.
c
The C-terminal anchor peptide sequence is TLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED.