Table 1.
Predicted antigenic epitopes within the MIC-A protein. A total of 14 epitopes are predicted, with six of those found within the transmembrane topology depicting potential antigenic peptides. More so, seven of the predicted epitopes are located outside the transmembrane topology and another one is found on the transmembrane itself; these are non-antigenic in nature.
S/N | Sequence | Start Position | End Position | TMHMM | TMHMM Score |
---|---|---|---|---|---|
1 | GPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWGSVQSGFL TEVHLDGQPFLRCDRQKCRA |
4 | 66 | Outside | 0.04288 |
2 | RMTLAHI | 97 | 103 | Inside | 0.66097 |
3 | EGLHSLQEIRVCEI | 108 | 121 | Outside | 0.25679 |
4 | SSQHFYYDGELFLSQ | 129 | 143 | Outside | 0.21811 |
5 | KTHYHAMHADCLQELRR | 177 | 193 | Inside | 0.76815 |
6 | LKSGVVLRR | 195 | 203 | Inside | 0.56129 |
7 | VPPMVNV | 205 | 211 | Outside | 0.25411 |
8 | ITVTCRASG | 221 | 229 | Inside | 0.73449 |
9 | DGVSLSH | 242 | 248 | Outside | 0.17761 |
10 | YQTWVATRICQ | 264 | 274 | Inside | 0.87917 |
11 | QRFTCYM | 278 | 284 | Inside | 0.79020 |
12 | STHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKK | 291 | 333 | Transmembrane | 0.00369 |
13 | EGPELVSLQVLDQHPVGT | 339 | 356 | Outside | 0.07341 |
14 | TQLGFQPLMS | 363 | 372 | Outside | 0.17418 |