Skip to main content
. 2018 May 31;13(5):e0197742. doi: 10.1371/journal.pone.0197742

Fig 2. Complete Substitution Analysis of Cap18 measuring the antimicrobial activity against Yersinia ruckeri.

Fig 2

The original Cap18 sequence (GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY) and amino acid assignments are presented in the first two rows. The second column identifies the amino acid substitution at each position (A-Y). Each box in the matrix represents a Cap18 peptide harboring one single amino acid substitution compared to the original Cap18 sequence. For example, the amino acid sequence of the peptide in column 1/row 1 is ALRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, the sequence of the peptide in column 1/row 2 is CLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, the sequence of peptide in column 2/row 1 is GARKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY etc.; the values within each box represent a MIC value (μg/ml) against Yersinia ruckeri. Grey boxes represent the original Cap18 sequence. NS = no MIC value determination possible due to the insolubility of the peptide in DMSO.