Skip to main content
. 2018 May 31;13(5):e0197742. doi: 10.1371/journal.pone.0197742

Fig 6. Complete Substitution Analysis of Cap18 measuring the hemolytic activity of Cap18 peptides against horse erythrocytes.

Fig 6

The original Cap18 sequence (GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY) and amino acid assignments are presented in the first two rows. The second column identifies the amino acid substitution at each position (A-Y). Each box in the matrix represents a Cap18 peptide harboring one single amino acid substitution compared to the original Cap18 sequence. For example, the amino acid sequence of the peptide in column 1/row 1 is ALRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, the sequence of the peptide in column 1/row 2 is CLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, the sequence of peptide in column 2/row 1 is GARKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY etc.; the values within each box represent the hemolytic activity measured relative to full lysis by 0.2% Trition X-100. The final peptide concentration in the assay is 32 μg/ml. Grey boxes with X represent the original Cap18 sequence. NS = no MIC value determination possible due to the insolubility of the peptide in DMSO.