Table 1.
Display of proteoforms originating from 3 different canonical proteins.
| ID | Identifier and proteoforms | Charge (z) | m/z observed | Deconvoluted mass m/z | Sequence found | PTMs | Position in the full sequence | p-Value | Retention time (min) | Mass error (ppm) |
|---|---|---|---|---|---|---|---|---|---|---|
| Clusterin P10909 | Clus-01 | 11 | 615.0491 | 6754.46 | V.ASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE. | M42(Oxidation) | 390–449 (C ter) | 0.004 | 66.3 | 0.1 |
| Clusterin P10909 | Clus-02 | 12 | 562.3772 | 6736.48 | V.ASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE. | 390–449 (C ter) | 0.02 | 66.3 | 2.4 | |
| Clusterin P10909 | Clus-03 | 11 | 608.6813 | 6684.44 | A.SHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE. | M41(Oxidation) | 391–449 (C ter) | 0.001 | 66.3 | 2.2 |
| Clusterin P10909 | Clus-04 | 7 | 523.2827 | 3656.95 | V.PVEVSRKNPKFMETVAEKALQEYRKKHREE. | 420–449 (C ter) | 0.222 | 49.3 | 3.4 | |
| Secretogranin-2 P13521 | SCG2 | 4 | 920.2106 | 3677.82 | R.TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ.K | 182–214 | 0.02 | 84.9 | 0.2 | |
| Chromogranin-A P10645 | Chrom-01 | 4 | 519.3029 | 2073.19 | S.AIAAELEKVAHQLQALRRG. | E3->A (Mutation) | 439–457 | 0.06 | 75.4 | 2.9 |
| Chromogranin-A P10645 | Chrom-02 | 9 | 569.9577 | 5119.57 | R.GYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG. | 413–457 (C ter) | 0.1 | 77.3 | 1.4 |