Skip to main content
. 2018 Sep 7;9:2153. doi: 10.3389/fmicb.2018.02153

Table 2.

Cationic antimicrobial peptides used in this study: sequence, origin, and structure.

Peptide Sequence Origin Structure
Cap18 GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY Mammalian, rabbit, neutrophils α-helical
Cap11 GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI Mammalian, guinea pig, neutrophils α-helical
Cap11-1-18m2 KLRKLFRKLLKLIRKLLR Truncated derivative of Cap11
Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Mammalian, pig, small intestine α-helical
Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG-NH2 Insects, giant silk moth, pupae α-helical
Melittin GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 Insects, honey bee α-helical
Indolicidin ILPWKWPWWPWR-NH2 Mammalian, bovine neutrophils extended