Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Data from physicochemical property prediction.
| Peptides | Sequence | α-Helicity (%) | Hydrophobicity (H) | Hydrophobic moment (µH) | Net charge |
|---|---|---|---|---|---|
| DRS-CA-1 | ALWKDLLKNVGKAAGKAVLNKVTDMVNQ.NH2 | 25.3 | 0.291 | 0.263 | +3 |
| DRS-DU-1 | ALWKSLLKNVGKAAGKAALNAVTDMVNQ.NH2 | 27.9 | 0.331 | 0.255 | +3 |
| DP-1 | ALWKSLLKNVGKA.NH2 | 16.1 | 0.429 | 0.645 | +3 |
| DP-2 | GRKKRRQRRRGALWKSLLKNVGKA.NH2 | 11.4 | −0.112 | 0.358 | +11 |
