TABLE 1.
Amino acid sequences of ribosomal and stress response proteins tentatively underlying the species-specific MALDI-TOF spectrum peaks in K. pneumoniae and K. variicolaa
Protein | Species | Amino acid sequenceb | Modification | m/z | m/(2z) |
---|---|---|---|---|---|
L31p | K. pneumoniae | MKKGIHPNYDEITATCSCGNVMKIRSTVGHDLNLDV[. . .]* | 7,742 | 3,871 | |
K. variicola | MKKGIHPKYEEITATCSCGNVMKIRSTVGHDLNLDV[. . .]* | 7,770 | 3,885 | ||
L28p | K. pneumoniae | (M)SRVCQ[. . .]VSAKGMRVIDKKGIDTVLAELRARGEKY* | dMet | 8,875 | 4,437 |
K. variicola | (M)SRVCQ[. . .]VSAKGMRVIDKKGIDTVLSELRARGEKY* | dMet | 8,891 | 4,446 | |
S15p | K. pneumoniae | (M)SLSVE[. . .]QRRKLLDYLKRKDVARYAALIERLGLRR* | dMet | 10,077 | 5,038 |
K. variicola | (M)SLSVE[. . .]QRRKLLDYLKRKDVARYSALIERLGLRR* | dMet | 10,062 | 5,031 | |
YjbJ | K. pneumoniae | MNKDEIGGNWKQFKG[. . .]YEKDQAEKEVSDWEHKNDYRW* | 8,309 | 4,155 | |
K. variicola | MNKDEIGGNWKQLKG[. . .]YAKDQAEKEVSDWEHKNDYRW* | 8,217 | 4,108 |
The calculated molecular mass was used to determine the theoretical peak position of the single (m/z) or double [m/(2z)] charged ion of the unmodified or demethionated (dMet) form of the protein.
Amino acid substitutions that lead to a mass change are underlined. Ellipses within brackets indicate parts of the sequence without differences; asterisks indicate stop codons.