Table 3.
Identified putative AMP sequences with no significant identity to the known proteins, less than 80% identity to known AMP sequences or 100% identity to proteins stored at NCBI database with < 70% query cover and their physico-chemical characteristics
| # | Sequence | Species | Charge | Ha |
|---|---|---|---|---|
| No identity to proteins stored at NCBI nr database | ||||
| 1 | FLGALGNALSRVLGK | R. temporaria | +3 | 0.813 |
| 2 | FIGALVNALTRVLGK | R. temporaria | +3 | 1.213 |
| 3 | FIGALVHALTGILGK | R. temporaria | + 2 | 2.247 |
| 4 | LVPFIGRTLGGLLARFGK | R. temporaria | + 4 | 1.500 |
| 5 | VPQLCFKFQKVIYCEINRTLPNEA | R. dalmatina | + 2 | −0.625 |
| 6 | FSQLFFAWLLRLCRQ | P. kl. esculentus | +3 | 2.587 |
| 7 | GIVEAWPLR | P. ridibundus, R. dalmatina | + 1 | 1.133 |
| 8 | NNLRHIVAWCKNRNYSLAVCARFKPQ | R. temporaria | + 6 | −1.612 |
| 9 | NLLGFLQGAKDILKECEADNYQGWLCESYKPQ | R. dalmatina | −1 | −1.250 |
| 10 | FLPLVLGKTHSEQAEILSWKSSNVEYHLPKCTTDV | P. ridibundus, R. dalmatina | 0 | −0.763 |
| 11 | FLPLIAGLWVNCSANNPKMLKLWK | P. kl. esculentus | + 4 | 1.363 |
| 12 | FLPICDKSALRFVGKV | P. ridibundus | +3 | 0.494 |
| 13 | EMPMKKKEETIQKKGMLKWKTIFTSHCWSFE | P. ridibundus | + 4 | −1.835 |
| 14 | RGLLDPITGLVGGLLR | H. arborea | + 2 | 1.213 |
| < 80% identity to proteins stored at NCBI database | ||||
| 15 | FLGFVGQALNALLGKLGK | R. dalmatina | +3 | 1.550 |
| 16 | FLPAIAGILSQIFGK | P. kl. esculentus | + 2 | 2.540 |
| 17 | FFPAFLKVAAKVVPSIICSITKNVET | P. kl. esculentus | +3 | 0.573 |
| 18 | IVPILLGVVPQLVCAITKKC | R. dalmatina, R. temporaria | +3 | 1.675 |
| 19 | IIPLLLGKVVCAITKKC | R. dalmatina | + 4 | 1.271 |
| 20 | LVPMFLSKLICFITKKC | R. temporaria | + 4 | 1.918 |
| 21 | GLEVLGKILSGILGK | R. dalmatina, Rana arvalis | + 2 | 1.220 |
| 22 | LLGAALSALSSVIPSVISWFQKG | Rana arvalis | + 2 | 1.670 |
| 23 | LANRAARNTSQNVLNAITCTL | R. dalmatina | +3 | −1.662 |
| 24 | ADFLDKLRNFAAKNLQNKASL | P. ridibundus | +3 | −1.595 |
| 25 | EMLRKKEETIQKKGMLKWKNDFYQSLLEF | P. ridibundus | +3 | −1.779 |
| 100% identity to proteins stored at NCBI database with < 70% query cover | ||||
| 26 | QKTYNRRPPGWSLYVFHQQISNLELEVI | P. kl. esculentus | + 2 | −0.654 |
| 27 | FVPLLVSKLVCVVTKNVRIWKLELEII | Rana arvalis | +3 | 1.663 |
| 28 | FVPLLVSKLVCVVTKNVRTLET | Rana arvalis | +3 | 0.455 |
| 29 | FLPIVTNLLLRFVG | R. dalmatina | + 2 | 3.729 |
aCalculated using the CCS consensus hydrophobicity scale [50]