1 |
LSD144 (LW144a and LW144b) (Kelch-like protein); LSD145 (Ankyrin repeat protein) |
LSD144: 36 aa; LSD145: 44 aa; |
LSD144: 218 I>D = N; 234 S>N; 338; Translation identical to minor parent, thus 252–267 is FIYISDPNWYSKKYDI; 337^338 del>E; 375 Y>E; 385 D>S; 423 S>T; 456 E>A; 529 S>A; 548 terminate similar to major parent; LSD145: 8 I>V; 22 I>L; 121 S>G; 139 I>V; 144 V>I; 181 T>I; 189 F>L = L; 196 G>N; 202 S>R; 205 N>D; 210 T>S; 216 C>S; 241 K>Q; 261 M>V; 269 L>I; 273 N>S; 292 S>N; 309 S>P; 336 V>I; 340 I>V; 341 E>D; 342 H>N; 349 D>E; 353 Y>H; |
2 |
LSD134 (LW134a and LW134b); LSD135 (putative IFN-alpha/beta binding protein); LSD136 (hypothetical protein); LSD137 (hypothetical protein); LSD138 (IG domain OX-2-like protein) |
LSD134: 81 aa; LSD135: 7 aa; LSD136: 3 aa; LSD137: 4 aa; LSD138: 6 aa; |
LSD134: 2 G>K; Translation similar to minor parent, thus 720–783 is QSLRRYSSSDYETIGENIYESIREPEYALLSKPRVLNPRSHIPLPSVPKDDIPFTQQKRKVID; 886 S>N; 1056 K>R = R; 1900 S>A; 2007^2008 del>N; 2018 N>del; LSD135: 11 L>S; 65 T>K; 129 A>T; 156 R>Q; 213 I>L; 249 S>P; 346 R>Y; LSD136: 32 V>I; 76 S>L; 80 N>D = D; 141 V>I; LSD137: 58 H>P; 106 V>I; 143 T>A; 212 S>A; LSD138: 14 G>S; 24 S>T; 43 S>N; 93 V>I; 100 Q>K; |
3 |
LSD008 (Putative soluble interferon gamma receptor) LSD009 (Putative alpha amanitin-sensitive protein) |
LSD008: 20 aa; LSD009: 13 aa; |
LSD008: 16 S>Y; 32 N>K; 34 G>E; 36 I>T; 39 D>V; 40 N>S; 41 S>D; 45 K>R; LSD009: 129 R>K; 135 T>A; 142 T>A; 147 Y>H; 151 D>E; 166 H>R; 179 I>V; 185 I>M; 187 C>Y; 188 M>I; 200 K>T; 201 G>C; |
4 |
LSD131 (Superoxide dismutase-like protein); LSD132 (hypothetical protein); LSD133 (DNA ligase-like protein); LSD134 (LW134a) (Similar to variola virus B22R) |
LSD131: (53 aa truncation); LSD132: 5 aa; LSD133: 8 aa; |
LSD131: C-terminal identical to minor parent, thus 84–161 is FNNERHIGDLGNIYSNKYGISYIYILDGKISLVGDYSIIGRSLVISEKNDDLGKGYNFKSFIDGNSGNGVAYGIIGIA; LSD132: 19 V>L; 63^64 del> T; 69 L>V; 98 T>N; 145 G>D; LSD133: 165 V>I; 275 S>N; 312 L>S; 446 N>K; 514 S>A; |
5 |
LSD084 (Putative early transcription factor small subunit); LSD085 (RNA polymerase subunit); LSD086 (mutT motif protein); LSD087 (mutT motif protein); LSD088 (putative transcription termination factor); LSD089 (mRNA capping enzyme small subunit) |
LSD084: 2 aa; LSD085: 1 aa; LSD086: 9 aa; LSD087: 2 aa and 53 aa C-terminal truncation; LSD088: 1 aa; LSD089: 2 aa; |
LSD084: 353 L>G; 581 D>N; LSD085: 136 M>T; LSD086: 191 L>F; Translation similar to minor parent, thus 207–213 NTLVNSK; LSD087: 12 D>G; 46 V>I; C-terminal similar to minor parent, thus 199–253 SNKEIKSLVFFDSLYNGIEGDIIRFVLDISRLKCFGNKGYELYNKNTFKSLKSFF; LSD088: 24 V>I; LSD089: Identical to major parent; |
6 |
LSD154 (putative ER-localized apoptosis regulator); LSD155 (hypothetical protein); LSD156 (hypothetical protein) |
LSD155: No difference; LSD156: 2 aa |
LSD155: 36 I>N = N; 43 G>V = V; 80 S>T = T; 81 R>S = S; LSD156: 92 F>Y = Y; 136 F>I = I; 144 I>M; |
7 |
LSD049 (putative RNA helicase); LSD050 (putative metalloprotease); LSD051 (putative transcriptional elongation factor); LSD052 (hypothetical protein); LSD053 (putative glutaredoxin); LSD054 (hypothetical protein); LSD055 (Similar to G5.5R, RPO7); LSD056 (hypothetical protein); LSD057 (putative virion core protein) |
LSD049: 5 aa; LSD050: 1 aa; LSD051: No differences; LSD052: 1 aa; LSD053: No differences; LSD054: 3 aa; LSD055: No differences; LSD056: 1 aa; LSD057: 2 aa |
LSD049: 145 A>T; 623 K>R; 673 V>I; LSD050: Identical to major parent; LSD051: Identical to both parents; LSD052: 33 K>N; LSD053: Identical to both parents; LSD054: 54 S>G; 184 M>I; LSD055: Identical to both parents; LSD056: 171 K>R = R; 174 N>D; LSD057: 257 V>A; 372 V>I; |
8 |
LSD035 (LW036) (hypothetical protein); LSD037 (hypothetical protein); LSD038 (hypothetical protein); LSD039 (DNA polymerase) |
LSD037: 4 aa; LSD038: No differences; LSD039: 8 aa |
LSD037: 251 V>F; 300 V>I; 437 I>V; 564 G>V; LSD038: Identical to both parents; LSD039: Identical to major parent; |
9 |
LSD059 (putative myrostylated protein); LSD060 (putative myristylated IMV envelope protein); LSD061 (hypothetical protein); LSD062 (hypothetical protein); LSD063 (putative DNA-binding virion core protein) |
LSD059: 1 aa; LSD060: No differences; LSD061: 3 aa; LSD062: 2 aa; LSD063: No differences |
LSD059: Identical to major parent; LSD060: Identical to both parents; LSD061: 13 D>E; 82 L >S = A; LSD062: 185 R>K; 273 I>V; LSD063: Identical to both parents; |
10 |
LSD102 (hypothetical protein); LSD103 (putative virion core protein); LSD104 (putative IMV membrane protein); LSD105 (putative IMV membrane protein); LSD106 (putative virulence factor); |
LSD102: 3 aa; LSD103: 2 aa; LSD104: No differences; LSD105: No differences; LSD106: No differences |
LSD102: Identical to major parent; LSD103: 50 T>N; 72 P>T; 89 S>G = G; LSD104: Identical to both parents; LSD105: Identical to both parents; LSD106: Identical to both parents; |
11 |
LSD097 (hypothetical protein); LSD098 (putative early transcription factor large subunit); |
LSD097: 2 aa; LSD098: 6 aa; |
LSD097: 25 V>A; 65 L>V; LSD098: 652 T>I; |
12 |
LSD139 (putative Ser/Thr protein kinase); LSD140 (putative RING finger host range protein); LSD141 (putative EEV host range protein); |
LSD139: 5 aa; LSD140: 10 aa; LSD141: 4 aa; |
LSD139: 263 G>V; 272 S>P; LSD140: 5 S>I; 132 T>M>K; 187 K>N; 228 N>D; LSD141: 38 E>K |
13 |
LSD071 (RNA polymerase subunit); LSD072 (putative protein-tyrosine phosphatase); LSD073 (hypothetical protein) |
LSD071: 4 aa; LSD072: No differences; LSD073: 2 aa; |
LSD071: 879 N>S; LSD072: Identical to both parents; LSD073: 26 T>S |
14 |
LSD147 (ankyrin repeat protein) |
LSD147: 1 aa; |
LSD147: Identical to major parent; |
15 |
LSD081 (putative virion protein); LSD082 (uracil DNA glycosylase); |
LSD081: 2 aa; LSD082: 1 aa; |
LSD081: 227 S>N; LSD082: 54 R>Q |
16 |
LSD110 (putative DNA helicase transcriptional elongation factor); LSD111 (hypothetical protein) |
LSD110: 7 aa; LSD111: No differences; |
LSD010: Identical to major parent; LSD111: Identical to both parents; |
17 |
LSD108 (putative myristylated membrane protein) |
LSD108: 3 aa; |
LSD108: 171 S>A; |
18 |
LSD023 (hypothetical protein) |
LSD023: No differences; |
LSD023: Identical to both parents; |
19 |
LSD034 (putative PKR inhibitor); LSD036 (LW035a) (RNA polymerase subunit); |
LSD034: 1 aa; LSD036 (LW035a): 1 aa; |
LSD034: Identical to major parent; LSD035: P>S = S; LSD036: Identical to major parent; |
20 |
LSD019 (kelch-like protein) |
LSD019: 4 aa and a 150 aa N-terminal truncation |
Identical frameshift to LW019a and LW019b. LSD019: 84 A>V; 89 K>R; 104 V>A; |
21 |
LSD075 (RNA polymerase-associated protein) |
LSD075: 5 aa; |
LSD075: 692 S>N; 739 F>L; |
22 |
LSD091 (putative late transcription factor); LSD092 (putative late transcription factor); |
LSD091: No differences; LSD092: No differences; |
LSD091: Identical to both parents; LSD092: Identical to both parents; |
23 |
LSD027 (putative EEV maturation protein); |
LSD027: 6 aa |
LSD027: 327 D>N; |
24 |
LSD042 (hypothetical protein) |
LSD042: 4 aa; |
LSD042: 190 A>T; 230 P>S; |
25 |
LSD002 (hypothetical protein); LSD003 (putative ER-localized apoptosis regulator; |
LSD002: No differences; LSD003: 2 aa; |
LSD002: Identical to both parents; LSD003: Identical to major parent; |
26 |
LSD020 (ribonuclease reductase small subunit); LSD021 (hypothetical protein) |
LSD020: 3 aa; LSD021: 3 aa; |
LSD020: Identical to major parent; LSD21: 78 T>K; |
27 |
LSD079 (mRNA capping enzyme large subunit) |
LSD079: 4 aa; |
LSD079: Identical to major parent; |