Table 1.
Label | Amino Acid Sequence | *M.W. [kDa] | **Slope, m [°C/Log10(μM)] | Intercept, b [°C] |
---|---|---|---|---|
A192 | G(VPGAG)192Y | 73.6 | 8.0 ± 1.7 | 71.8 ± 2.6 |
CA192 | CypA-(VPGAG)192Y | 91.6 | 2.9 ± 2.2 | 53.1 ± 3.7 |
CypA amino acid sequence:
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Expected molecular weight based on the open reading frame for the expressed protein.
The ELP transition temperatures were by Eq. (9), yielding an intercept, b, at 1 μM, and a slope, m, representing the change in temperature upon a 10-fold change in concentration. Mean ± 95% CI.