Skip to main content
. Author manuscript; available in PMC: 2019 Dec 28.
Published in final edited form as: J Control Release. 2018 Oct 23;292:183–195. doi: 10.1016/j.jconrel.2018.10.026

Table 1.

Amino acid sequence and phase behavior of CA192.

Label Amino Acid Sequence *M.W. [kDa] **Slope, m [°C/Log10(μM)] Intercept, b [°C]
A192 G(VPGAG)192Y 73.6 8.0 ± 1.7 71.8 ± 2.6
CA192 CypA-(VPGAG)192Y 91.6 2.9 ± 2.2 53.1 ± 3.7

CypA amino acid sequence:

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

*

Expected molecular weight based on the open reading frame for the expressed protein.

**

The ELP transition temperatures were by Eq. (9), yielding an intercept, b, at 1 μM, and a slope, m, representing the change in temperature upon a 10-fold change in concentration. Mean ± 95% CI.