Table 1.
Minimal inhibitory concentration (MIC) of individual frog skin-derived antimicrobial peptides against amphibian bacterial pathogens.
| Pathogen | Species | AMP | Sequence | MIC | References |
|---|---|---|---|---|---|
| Aeromonas caviae | Phyllomedusa sauvagii | Dermaseptin-S1 | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | 0.5 | (140) |
| Dermaseptin-S2 | ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ | 1 | (140) | ||
| Dermaseptin-S3 | ALWKNMLKGIGKLAGKAALGAVKKLVGAES | 1 | (140) | ||
| Dermaseptin-S4 | ALWMTLLKKVLKAAAKAALNAVLVGANA | 0.5 | (140) | ||
| Dermaseptin-S5 | GLWSKIKTAGKSVAKAAAKAAVKAVTNAV | 35 | (140) | ||
| Aeromonas hydrophila | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | ND | (141) |
| Phyllomedusa sauvagii | Dermaseptin-S1 | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | ND | (142) | |
| Ranalexin | FLGGLIKIVPAMICAVTKKC | ND | (142) | ||
| Rana catesbeiana | CPF | GFASFLGKALKAALKIGANLLGGTPQQ-OH | ND | (142) | |
| Xenopus laevis | Magainin I | GIGKFLHSAGKFGKAFVGEIMKS | ND | (142) | |
| Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | ND | (142) | ||
| Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | ND | (141) | ||
| PGLa | GMASKAGAIAGKIAKVALKAL.NH2 | ND | (142) | ||
| Citrobacter freundii | Ascaphus truei | Ascaphin-8 | GFKDLLKGAAKALVKTVLF.NH2 | 6 | (143) |
| Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | 100 | (141) | |
| Leptodactylus pentadactylus | Leptoglycin | GLLGGLLGPLLGGGGGGGGGLL | 75 | (144) | |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 30 μg/ml | (99) | |
| Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 50 | (141) | ||
| Chryseobacterium meningiosepticum | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | ND | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | ND | (141) | |
| Klebsiella pneumoniae | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | 100 | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 50 | (141) | |
| Lactococcus lactis | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | 100 | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 100 | (141) | |
| Pseudomonas aeruginosa | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | 200 | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 50 | (141) | |
| Proteus mirabilis | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | ND | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | ND | (141) | |
| Serratia liquefaciens | Litoria ewingii | Aurein 2.1 | GLLDIVKKVVGAFGSL | 100 | (141) |
| Xenopus laevis | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS | 100 | (141) |
ND indicates not determined (i.e., at the level tested, the AMP was found to have no effect on the pathogen). MIC values are reported in μM unless indicated otherwise.