Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Observed molecular weights of OmpF peptide fragments digested with trypsin and measured by liquid chromatography-mass spectrometry
| Fragment | Peptide sequence | Theoretical M.W. (Da) | Observed M.W. (Da) | ||
|---|---|---|---|---|---|
| Lot 1 | Lot 2 | Lot 3 | |||
| 1 | YADVGSFNYGR | 1248.541 | 1249.605 | 1249.596 | 1249.638 |
| 2 | YDANNIYLAANYGETR | 1846.849 | 1847.867 | 1847.877 | 1847.931 |
| 3 | NYGVVYDALGYTDMLPEFGGDTAYSDDFFVGR | 3553.566 | 3554.815 | 3554.632 | 3554.830 |
| 4 | GETQINSDLTGYGQWEYNFQGNNSEGADAQTGNK | 3693.573 | 3693.868 | 3694.669 | |
