Table 1.

Characteristics of alfalfa-associated nucleorhabdovirus (AaNV) encoded proteins [sizes in amino acids (aa), molecular masses (MW) in kilo Dalton (kDa), the isoelectric points (IEP), predicted cell nuclear localisation signals (cNLS) and nuclear export signals (NES)]

Putative gene function	Gene	Size (aa)	MW (kDa)	pairwise aa sequence identity (%)		IEP	Predicted NLS					NES position
				BCaRV-1	DYVV		Position	Partite	aa sequence	cNLS Mapper Score	Predicted location
Nucleocapsid protein	N	443	50.3	33.5	36.6	7.1	408	Bic	RAGIKRQAGDHETQGTKRARTS	12.7	eN	351
Phosphoprotein	P	363	41.1	11.5	14	6.4	146	Monod	RGNKRRKRSD	10	eN	ND
Putative cell-to-cell movement protein	P3	322	37.2	14.6	22.4	8.6	17	Bi	PTKKRTSQDKYNFRSTESLYAEPYNKIIRTK	7	pN	ND
Matrix protein	M	277	31.4	14.9	16.5	7.6	213	Bi	RSSVKITGKQMRARSSSRSRSPYKVSLSSNKRTYLD	4.3	N/Cp	136
Unknown protein	U	113	12.4	NAa	NA	4.0	NDb	ND	ND	ND	NA	31
Glycoprotein	G	629	71.6	26.4	24.6	7.3	443	Bi	KSAYKKKLPYEVTAWNGDKIMSEYPYKNIVVE	6	pN	ND
RNA-dependent RNA polymerase	L	2038	234.8	35.8	36.7	7.8	780	Bi	EKTAIKRRMRAFRDDLGQKMKKR	10	eN	88,90 and 149

The amino acid sequence identities between the putative gene products of AaNV and those of black currant-associated rhabdovirus 1 (BCaRV-1; MF543022) and datura yellow vein virus (DYVV; NC_028231). The predicted protein cell nuclear localisation signal (cNLS; http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi) Mapper score and Nuclear export signals (NES) are also mentioned. The cut-off values of the cNLS mapper scores: 8, 9, or 10 = the protein is predicted to be exclusively localised to the nucleus (eN), 6, 7 or 8 = partially localised to the nucleus (pN), 3, 4, or 5 = localised to both the nucleus and the cytoplasm (N/Cp), and 1 or 2 = localised to the cytoplasm (Cp). ^aNA: not applicable. ^bND: not detectable. ^cBi: Predicted bipartite NLS^d Mono: Predicted monopartite NLS