TABLE 1.
OXA-48 pan-peptidome derived from in silico theoretical trypsin digestion
| OXA-48 family pan-peptidome | Mass | ESP predictiona | Core peptideb | Detected on Orbitrap | Detected on QTOF | Included in final method |
|---|---|---|---|---|---|---|
| ANQAFLPASTFK | 1,294.6790 | 0.85 | Yes | Detected | Detected | Yes |
| DEHQVFK | 902.4366 | 0.08 | Yes | Not detected | ||
| IPNSLIALDLGVVK | 1,451.8831 | 0.46 | Yes | Not detected | ||
| LHVSER | 740.4049 | 0.07 | Yes | Not detected | ||
| LYHNK | 674.3620 | 0.08 | Yes | Not detected | ||
| QAITK | 560.3402 | 0.06 | Yes | Not detected | ||
| QQGFTNNLK | 1,049.5374 | 0.48 | Yes | Detectedc | Detected | |
| YSVVPVYQEFAR | 1,457.7423 | 0.54 | No | Detected | Detected | Yes |
| QAMLTEANGDYIIR | 1,594.7893 | 0.64 | No | Detected | Detected | |
| DHDLITAMK | 1,043.5190 | 0.35 | No | Not detected | ||
| DIAAWNR | 845.4264 | 0.36 | No | Detected | ||
| EWQENK | 833.3788 | 0.06 | No | Not detected | ||
| IGWWVGWVELDDNVWFFAMNMDMPTSDGLGLR | 3,757.7276 | 0.03 | No | Not detected | ||
| ISATQQIAFLR | 1,247.7106 | 0.47 | No | Detected | ||
| MLHAFDYGNEDISGNVDSFWLDGGIR | 2,928.3257 | 0.05 | No | Detected | ||
| QIGEAR | 673.3627 | 0.06 | No | Not detected | ||
| SQGVVVLWNENK | 1,372.7219 | 0.61 | No | Detected | ||
| SWNAHFTEHK | 1,256.5807 | 0.13 | No | Detected | ||
| TGYSTR | 684.3311 | 0.07 | No | Not detected | ||
| VLALSAVFLVASIIGMPAVAK | 2,070.2395 | 0.17 | No | Not detected | ||
| WDGQTR | 762.3529 | 0.04 | No | Not detected |
a
Enhanced signature peptide: prediction tool based on protein sequence for any given peptide giving the likelihood the peptide will work well for mass spectrometry assay development (46).
b
Core peptides were defined as those tryptic peptides present in all 12 of the OXA-48 family members.
c
Detected on second Orbitrap run only.