Table 1.
Amino acid sequences of the signal peptides
|
Accession
No. (Uniprot) |
Signal Peptide | Protein name | Source | Amino Acid Sequence |
|---|---|---|---|---|
| P00634 | PPB_ECOLI | Alkaline phosphatase | Escherichia coli (strain K12) | MKQSTIALALLPLLFTPVTKA |
| P02932 | PHOE_ECOLI | Outer membrane pore protein E | Escherichia coli (strain K12) | MKKSTLALVVMGIVASASVQA |
| P0A910 | OMPA_ECOLI | Outer membrane protein A | Escherichia coli (strain K12) | MKKTAIAIAVALAGFATVAQA |
| P02931 | OMPF_ECOLI | Outer membrane protein F | Escherichia coli (strain K12) | MMKRNILAVIVPALLVAGTANA |
| P09169 | OMPT_ECOLI | Protease 7 | Escherichia coli (strain K12) | MRAKLLGIVLTTPIAISSFA |
| P06996 | OMPC_ECOLI | Outer membrane protein C | Escherichia coli (strain K12) | MKVKVLSLLVPALLVAGAANA |
| P13811 | ELBH_ECOLX | Heat-labile enterotoxin B chain | Escherichia coli | MNKVKFYVLFTALLSSLCAHG |
| P02943 | LAMB_ECOLI | Maltoporin | Escherichia coli (strain K12) | MMITLRKLPLAVAVAAGVMSAQAMA |
| P0AEX9 | MALE_ECOLI | Maltose-binding periplasmic protein | Escherichia coli (strain K12) | MKIKTGARILALSALTTMMFSASALA |
| P0AEG4 | DSBA_ECOLI | Thiol:disulfide interchange protein dsbA | Escherichia coli (strain K12) | MKKIWLALAGLVLAFSASA |
| P0AEE5 | DGAL_ECOLI | D-galactose-binding periplasmic protein | Escherichia coli (strain K12) | MNKKVLTLSAVMASMLFGAAAHA |
| P38683 | TORT_ECOLI | Periplasmic protein torT | Escherichia coli (strain K12) | MRVLLFLLLSLFMLPAFS |
| P0A855 | TOLB_ECOLI | Protein tolB | Escherichia coli (strain K12) | MKQALRVAFGFLILWASVLHA |
| P22542 | HSTI_ECOLX | Heat-stable enterotoxin II | Escherichia coli (strain K12) | MKKNIAFLLASMFVFSIATNAYA |
| P62593 | BLAT_ECOLX | Beta-lactamase TEM | Escherichia coli | MSIQHFRVALIPFFAAFCLPVFA |
| P00805 | ASPG2_ECOLI | l-asparaginase 2 | Escherichia coli (strain K12) | MEFFKKTALAALVMGFSGAALA |
| A2TJI4 | CEXE_ECOLX | Protein cexE | Escherichia coli | MKKYILGVILAMGSLSAIA |
| P05458 | PTRA_ECOLI | Protease 3 | Escherichia coli (strain K12) | MPRSTWFKALLLLVALWAPLSQA |
| P45523 | FKBA_ECOLI | FKBP-type peptidyl-prolyl cis–trans isomerase | Escherichia coli | MKSLFKVTLLATTMAVALHAPITFA |
| P69776 | LPP_ECOLI | Major outer membrane lipoprotein | Escherichia coli (strain K12) | MKATKLVLGAVILGSTLLAG |
| P31550 | THIB_ECOLI | Thiamine-binding periplasmic protein | Escherichia coli (strain K12) | MLKKCLPLLLLCTAPVFA |
| Q47537 | TAUA_ECOLI | Taurine-binding periplasmic protein | Escherichia coli (strain K12) | MAISSRNTLLAALAFIAFQAQA |
| P23857 | PSPE_ECOLI | Phage shock protein E | Escherichia coli (strain K12) | MFKKGLLALALVFSLPVFA |
| P07102 | PPA_ECOLI | Periplasmic appA protein | Escherichia coli (strain K12) | MKAILIPFLSLLIPLTPQSAFA |
| P34210 | OMPP_ECOLI | Outer membrane protease ompP | Escherichia coli (strain K12) | MQTKLLAIMLAAPVVFSSQEASA |
| P24093 | DRAA_ECOLX | Dr hemagglutinin structural subunit | Escherichia coli (strain K12) | MKKLAIMAAASMVFAVSSAHA |
| P0A915 | OMPW_ECOLI | Outer membrane protein W | Escherichia coli (strain K12) | MKKLTVAALAVTTLLSGSAFA |
| P0AFI5 | PBP7_ECOLI | D-alanyl-D-alanine endopeptidase | Escherichia coli (strain K12) | MPKFRVSLFSLALMLAVPFAPQAVA |
| P33590 | NIKA_ECOLI | Nickel-binding periplasmic protein | Escherichia coli (strain K12) | MLSTLRRTLFALLACASFIVHA |
| P0ADV1 | LPTA_ECOLI | Lipopolysaccharide export system protein lptA | Escherichia coli (strain K12) | MKFKTNKLSLNLVLASSLLAASIPAFA |
| P16397 | SUBF_BACSU | Bacillopeptidase F | Bacillus subtilis | MRKKTKNRLISSVLSTVVISSLLFPGAAGA |
| Q02113 | CWBA_BACSU | Amidase enhancer | Bacillus subtilis | MKSCKQLIVCSLAAILLLIPSVSFA |
| P34957 | QOX2_BACSU | Quinol oxidase subunit 2 | Bacillus subtilis | MVIFLFRALKPLLVLALLTVVFVLGG |
| O07921 | CHIS_BACSU | Chitosanase | Bacillus subtilis | MKISMQKADFWKKAAISLLVFTMFFTLMMSETVFA |
| P21130 | SACB_BACAM | Levansucrase | Bacillus amyloliquefaciens | MNIKKIVKQATVLTFTTALLAGGATQAFA |
| P39824 | BLAC_BACSU | Beta-lactamase | Bacillus subtilis | MKLKTKASIKFGICVGLLCLSITGFTPFFNSTHAEA |
| P07980 | GUB_BACAM | Beta-glucanase | Bacillus amyloliquefaciens | MKRVLLILVTGLFMSLCGITSSVSA |
| P31797 | CDGT_BACST | Cyclomaltodextrin glucanotransferase | Bacillus stearothermophilus | MRRWLSLVLSMSFVFSAIFIVSDTQKVTVEA |
| P06874 | THER_BACST | Thermolysin | Bacillus stearothermophilus | MNKRAMLGAIGLAFGLLAAPIGASA |
| P00808 | BLAC_BACLI | Beta-lactamase | Bacillus licheniformis | MKLWFSTLKLKKAAAVLLFSCVALAG |
| P06278 | AMY_BACLI | Alpha amylase | Bacillus licheniformis | MKQQKRLYARLLTLLFALIFLLPHSAAAA |
The amino acids in the n-region are boldfaced and the underlined amino acids shows the c-region.