Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Sequence of immunogenic peptides used in the present study
| Peptide name | Sequence | Immunogenicity |
|---|---|---|
| PCSK9 | S-I-P-W-N-L-E-R-I-T-P-V-R | B cell epitope |
| Tetanus | A-Q-Y-I-K-A-N-S-K-F-I-G-I-T-E-L | T cell epitope |
| IFPT | *CGGGSIPWNLERITPVRAQYIKANSKFIGITEL |
Bold amino acid codes are as a linker sequence for conjugating with DSPE-PEG-Mal. IFPT – immunogenic fused PCSK9-tetanus.
