Table 2.
Primary antibodies used in the study
| Antigen (clone) | Origin | Dilution | Supplier | Catalogue number |
|---|---|---|---|---|
| S100P | Rabbit | 1 : 1000 | DAKO, Glostrup, Denmark | Z 0311 |
| P200 kDa NF (RT‐97) | Mouse | 1 : 1000 | Boehringer‐Mannheim, Mannheim, Germany | 1178709 |
| PGP 9.5 | Rabbit | 1 : 1000 | Abcam, Hamburg, Germany | ab10404 |
| Cytokeratin 20 | Mouse | Prediluted | Leica, Newcastle, UK | PA0022 |
| Piezo2 | Rabbit | 1 : 500 | Sigma Aldrich, St. Louis, MO, USA | HPA040616 |
| BDNF | Rabbit | 1 : 200 | Chemicon Int, Temecula, CA, USA | AB1534SP |
| TrkB | Rabbit | 1 : 200 | Santa Cruz Biotechnology, Santa Cruz, CA, USA | SC12 |
BDNF, brain‐derived neurotrophic factor; NF, neurofilament; NSE, neuron‐specific enolase.
The antibody against BDNF is directed against the sequence H2N‐HSDPARRGEL‐COOH (manufacturer's note); the antibody anti‐TrkB was directed against the residues 794‐808 of the intracytoplasmic domain of human TrkB (manufacturer's note); the amino acid sequence recognized by the antibody against Piezo2 is FEDENKAAVRIMAGDNVEICMNLDAASFSQHNP (manufacturer's information).