. 2013 Oct 9;33(41):16189–16199. doi: 10.1523/JNEUROSCI.0076-13.2013

Table 2.

Protein identification by LC-MS/MS^a

Peptide	Start	End	Score	M/z (Obs)	Mr (Exp)	Mr (Calc)	Missed cleavage	Sequence	Modification
CaNA (isoform α): 5 peptides; protein score: 98; protein mass: 59,291 Da; peptide coverage: 15%
1	56	63	34.2	458.7583	915.5021	915.5025	0	`R.LEESVALR`
2	155	163	23.9	593.2999	1184.5853	1184.5866	0	`R.HLTEYFTFK`
3	101	112	56.0	624.3219	1246.6292	1246.6306	0	`K.LFEVGGSPANTR`
4	113	122	29.6	630.8168	1259.6191	1259.6186	0	`R.YLFLGDYVDR`
5	425	441	65.0	794.4231	1586.8317	1586.8338	0	`K.GLTPTGMLPSGVLSGGK`	Oxidation (M)
CaNA (isoform β): 4 peptides; protein score: 63; protein mass: 59,721 Da; peptide coverage: 11%
1	164	172	23.9	593.2999	1184.5853	1184.5866	0	`R.HLTEYFTFK`
2	110	121	56.0	624.3219	1246.6292	1246.6306	0	`K.LFEVGGSPANTR`
3	122	131	29.6	630.8168	1259.6191	1259.6186	0	`R.YLFLGDYVDR`
4	147	157	29.7	668.4056	1334.7966	1334.7962	0	`K.ILYPSTLFLLR`
CaNB (isoform 1): 2 peptides; protein score: 24; protein mass: 19,402 Da; peptide coverage: 11%
1	29	57	18.1	1101.5567	3301.6482	3301.65	1	`K.KLDLDNSGSLSVEEFMSLPELQQNPLVQR`	Oxidation (M)
2^b	148	165	24.2	513.0169	2048.0383	2048.0401	1	`R.ISFEEFCAVVGGLDIHKK`
Calmodulin: 2 peptides; protein score: 29; protein mass: 16,827 Da; peptide coverage: 22%
1	92	107	28.7	585.6269	1753.859	1753.8635	1	`R.VFDKDGNGYISAAELR`
2	15	31	23.3	615.6347	1843.8824	1843.884	1	`K.EAFSLFDKDGDGTITTK`

^aFor each peptide identified, the position in protein sequence, Mascot score, experimental and calculated masses, number of trypsin missed cleavage and sequence are indicated.

^bFor CaNB (isoform 1), peptide 2 did not meet the score requirements set for our experiment but was considered as a genuine identification after manual validation.