Figure - PMC

Skip to main content

An official website of the United States government

Here's how you know

Here's how you know

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

View full-text article in PMC

. 2019 Jul 5;10:863. doi: 10.3389/fphys.2019.00863

Search in PMC
Search in PubMed
View in NLM Catalog
Add to search

Copyright © 2019 Qile, Ji, Houtman, Veldhuis, Romunde, Kok and van der Heyden.

This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

PMC Copyright notice

Amino acid alignment of C-termini of human K_IR2.1, K_IR2.2, K_IR2.3, K_IR2.4, and K_IR2.6 encompassing the PEST domain region of K_IR2.1 indicated by double line above the alignment. Amino acid sequences are depicted in single letter code. Identical residues with respect to K_IR2.1 are depicted in white font on a black background. K_IR2.4 contains a potential PEST sequence extending from 378 to 424 (KSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGAASPR). PEST domains in K_IR2.1 and K_IR2.4 are indicated in italic. PEST scores are depicted at the right side of the sequences.