FIGURE 1.
Amino acid alignment of C-termini of human KIR2.1, KIR2.2, KIR2.3, KIR2.4, and KIR2.6 encompassing the PEST domain region of KIR2.1 indicated by double line above the alignment. Amino acid sequences are depicted in single letter code. Identical residues with respect to KIR2.1 are depicted in white font on a black background. KIR2.4 contains a potential PEST sequence extending from 378 to 424 (KSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGAASPR). PEST domains in KIR2.1 and KIR2.4 are indicated in italic. PEST scores are depicted at the right side of the sequences.