Skip to main content
. 2019 Jul 18;14(7):e0219390. doi: 10.1371/journal.pone.0219390

Table 1. Nominated proteins based on biological process involvement and protein score, using MALDI-TOF MS and LC-MS/MS data.

Database Protein name Protein score Peptide sequence Biological process Subcellular distribution
XP_010329708.1 Sentrin-specific protease 7 isoform X1 (SENP7) 29 LNLSERIPR Adenylate cyclase-modulating G-protein-coupled receptor signaling pathway Nucleus and plasma membrane
XP_021512678.1 Histone acetyltransferase KAT2B (KAT2B) 25 VYPGLLCFK Cell cycle arrest, chromatin remodeling Nucleus and cytoskeleton
EHB18528.1 Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 (PPRC1) 17 AHDHYQRQR Positive regulation of DNA-binding transcription factor activity Nucleus
ERE86066.1 Required for meiotic nuclear division protein 1-like protein (RMND1) 9 TLALSTYFHR Positive regulation of mitochondrial translation Mitochondrion
A0A286Y4B2 E3 ubiquitin-protein ligase DTX3L (DTX3L) 15 TLYGIQTGNQPK Histone ubiquitination Cytosol, endosome, lysosome and nucleus
XP_012863361.1 Zinc finger protein 699 (ZNF699) 14 EYGEACSSPSSIGPPVR Regulation of transcription Nucleus
XP_004612329.1 Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) 20 TDSMEILTSDIIDGLLK Activation of MAPKK activity Nucleus and cytoplasm
XP_021074063.1 V-type proton ATPase subunit E 2 (ATP6V1E2) 16 VCNTLESRLNLAAMQK ATP hydrolysis coupled proton transport Membrane
XP_010964328.1 Inactive phospholipase C-like protein 2 (PLCL2) 17 VMVMTSPNVEESYLPSPDVLK Intracellular signal transduction Cytoplasm
ELK17433.1 Trinucleotide repeat-containing protein 18 protein (TNRC18) 16 NSSGKLSGKPLLTSDAYELGAGMR Chromatin silencing Cytosol, mitochondrion, nucleus and other locations
XP_007951446.1 Collagen type XII alpha-1 chain (COL12A1) 23 DYKPQVGVIVDPSTKTLSFFNK Cell adhesion Extracellular matrix
XP_004267830.1 Zinc finger protein 451 isoform X2 (ZNF451) 18 DTSPFQPNPPAGGPIVEALEHSKR Nucleic acid binding Nucleus
XP_015104668.1 Protocadherin Fat 1 isoform X3 (FAT1) 16 GNPPMSEITSVHIFVTIADNASPKFTSK Homophilic cell adhesion via plasma membrane adhesion molecules Plasma membrane and integral component of membrane
XP_016818046.1 CASP-like protein 4A2 (CASPL4A2) 22 SAASPGPAPAAGDPGGSARPRPAAPLGSALALAF Iron–sulfur cluster binding Plasma membrane
XP_003924923.1 Centrosomal protein of 192 kDa isoform X1 (CEP192) 21 SGNLLETHEVDLTSNSEELDPIRLALLGK Centrosome-templated microtubule nucleation Cytoskeleton
ERE87034.1 Glypican-5 (GPC5) 13 GMCKDLTKPMQHHVTVIAASTECVVTLK Regulation of signal transduction Plasma membrane and extracellular space
XP_010635607.1 Cell-cycle checkpoint protein RAD17 isoform X2 (RAD17) 13 LLFPKEIQEECSILNISFNPVAPTIMMK Cell cycle Nucleus
ABU41662.1 Toll-like receptor 4 variant 1 (TLR4) 3 MMSASRLAGTLIPAMAFLSCVRPESWEPCVE Activation of MAPK activity Early endosome and cell membrane