Key resources table.
| Reagent type (species) or resource |
Designation | Source or reference | Identifiers | Additional information |
|---|---|---|---|---|
| Gene (Oryzias latipes) | npba | DOI: 10.1210/en.2013-1806 | Genbank:NM_001308979 | |
| Gene (O. latipes) |
npbb | NBRP Medaka | clone ID:olova57o22; clone ID:olova6h09; clone ID:olova8d12; clone ID:olova13m04; clone ID:olova28d23; clone ID:olova58i17 | |
| Gene (O. latipes) | npbwr2 | Genbank:LC375958 | ||
| Gene (O. latipes) | actb | Genbank:NM_001104808 | ||
| Strain, strain background (O. latipes) | d-rR | NBRP Medaka | strain ID:MT837 | maintained in a closed colony over 10 years in Okubo lab |
| Genetic reagent (O. latipes) | ΔERE mutant | this paper | generated and maintained in Okubo lab | |
| Genetic reagent (O. latipes) | npba-GFP transgenic | this paper | generated and maintained in Okubo lab | |
| Genetic reagent (O. latipes) | npba-/- | this paper | generated and maintained in Okubo lab | |
| Genetic reagent (O. latipes) | npbb-/- | this paper | generated and maintained in Okubo lab | |
| Genetic reagent (O. latipes) | npbwr2-/- | this paper | generated and maintained in Okubo lab | |
| Cell line (Homo sapiens) | HEK293T | Riken BRC Cell Bank | Cell number:RCB2202; RRID:CVCL_0063 | |
| Cell line (Escherichia coli) | DY380 | DOI: 10.1038/35093556; DOI: 10.1006/geno.2000.6451 | ||
| Transfected construct | pcDNA3.1/V5-His-TOPO | Thermo Fisher Scientific | Thermo Fisher Scientific:K480001 | |
| Transfected construct | pGL4.29 | Promega | Promega:E8471 | |
| Transfected construct | pGL4.74 | Promega | Promega:E6921 | |
| Antibody | anti-Npba antibody | this paper | RRID:AB_2810229 | rabbit polyclonal; against the entire Npba polypeptide (1:500 or 1:1000) |
| Antibody | Dylight 549-conjugated goat anti-rabbit IgG | Vector Laboratories | Vector Laboratories:DI-1549; RRID:AB_2336407 |
(1:500 or 1:1000) |
| Antibody | Alexa Flour 488-conjugated goat anti-rabbit IgG | Thermo Fisher Scientific | Thermo Fisher Scientific:A-11070; RRID:AB_2534114 |
(1:500) |
| Antibody | horseradish peroxidase-conjugated anti-fluorescein antibody | PerkinElmer | PerkinElmer:NEF710001EA; RRID:AB_2737388 | (1:500 or 1:1000) |
| Antibody | alkaline phosphatase-conjugated anti-DIG antibody | Roche Diagnostics | Roche Diagnostics:11093274910; RRID:AB_514497 | (1:500–1:10000) |
| Recombinant DNA reagent | medaka bacterial artificial chromosome (BAC) clone | NBRP Medaka | clone ID:180_I09 | |
| Recombinant DNA reagent | phrGFP II-1 mammalian expression vector | Agilent Technologies | Agilent Technologies:240143 | |
| Recombinant DNA reagent | pGEM-Teasy vector | Promega | Promega:A1360 | |
| Peptide, recombinant protein | Npba polypeptide | this paper | WYKQVAGPSYYSVGRASGLLSGIRRSPHV-NH2 | |
| Peptide, recombinant protein | Npbb polypeptide | this paper | WYKQSTGPIFYPVGRASGLLSGIRRSPYV-NH2 | |
| Commercial assay or kit | Dual-Luciferase Reporter Assay System | Promega | Promega:E1910 | |
| Commercial assay or kit | RNeasy Lipid Tissue Mini Kit | Qiagen | Qiagen:74804 | |
| Commercial assay or kit | RNeasy Plus Universal Mini Kit | Qiagen | Qiagen:73404 | |
| Commercial assay or kit | Omniscript RT Kit | Qiagen | Qiagen:205111 | |
| Commercial assay or kit | SuperScript VILO cDNA Synthesis Kit | Thermo Fisher Scientific | Thermo Fisher Scientific:11754050 | |
| Commercial assay or kit | LightCycler 480 SYBR Green I Master | Roche Diagnostics | Roche Diagnostics:04887352001 | |
| Commercial assay or kit | Golden Gate TALEN and TAL Effector Kit 2.0 | Addgene | Addgene:1000000024 | |
| Commercial assay or kit | mMessage mMachine SP6 Kit | Thermo Fisher Scientific | Thermo Fisher Scientific:AM1340 | |
| Commercial assay or kit | Marathon cDNA Amplification Kit | Takara Bio | Takara Bio:634913 | |
| Commercial assay or kit | Power SYBR Green PCR Master Mix | Thermo Fisher Scientific | Thermo Fisher Scientific:4367659 | |
| Commercial assay or kit | TSA Plus Fluorescein System | PerkinElmer | PerkinElmer:NEL741001KT | |
| Chemical compound, drug | aromatase inhibitor (AI); Fadrozole | Sigma-Aldrich | Sigma-Aldrich:F3806-10MG | |
| Chemical compound, drug | estradiol-17β; E2 | Fujifilm Wako Pure Chemical Corporation | Fujifilm Wako Pure Chemical Corporation:058–04043 | |
| Chemical compound, drug | 11-ketotestosterone; KT | Cosmo Bio | Cosmo Bio:117 ST | |
| Software, algorithm | GraphPad Prism | GraphPad Software | RRID:SCR_002798 | |
| Software, algorithm | Adobe Photoshop | Adobe Systems | RRID:SCR_014199 | |
| Software, algorithm | ImageJ | http://rsbweb.nih.gov/ij/ | RRID:SCR_003070 | |
| Software, algorithm | InterProScan | http://www.ebi.ac.uk/interpro/search/sequence-search | RRID:SCR_005829 | |
| Software, algorithm | SignalP | http://www.cbs.dtu.dk/services/SignalP/ | RRID:SCR_015644 | |
| Software, algorithm | ClustalW | http://clustalw.ddbj.nig.ac.jp/index.php | RRID:SCR_017277 | |
| Software, algorithm | Jaspar | http://jaspar.genereg.net/ | RRID:SCR_003030 | |
| Other | DAPI stain | Thermo Fisher Scientific | Thermo Fisher Scientific:D1306; RRID:AB_2629482 | (1:1000) |