Figure 6.

Effect of O-glycan biosynthesis gene disruptions on protein glycosylation. A, DsbA1-derived glycopeptide ²³VQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGK⁶⁴ indicating the sites of HCD fragmentation. B, four glycoforms observed corresponded to glycan A (HexNAc–HexNAc–Hex, m/z 1543.10, +3, 4626.266 Da), glycan B (HexNAc–HexNAc-262, m/z 1576.44, +3), QuiNAc-Rha (m/z 1464.75, +3, 4391.226 Da), and a single HexNAc (m/z 1421.39, +3, 4261.146 Da). C, semi-quantitative comparison of each glycoform in different genetic backgrounds using the area under the curve of the extracted ion chromatograms for all observed glycoforms of the DsbA1 peptide.