Table 2.
Antimicrobial active peptides derived from the LG4 modules of laminin α3, α4 and α5 chains
| Chain | Peptide | Sequence | IC901, µM |
|||
|---|---|---|---|---|---|---|
| S. aureus 113 | E. coli K12 | P. aeruginosa 27853 | C. albicans 9028 | |||
| α3 | 3-SFM29 | SFMALYLSKGRLVFALGTDGKKLRIKSKE | ~2 | ~2 | ~1 | ~3 |
| α4 | 4-END31 | ENDFMTLFLAHGRLVYMFNVGHKKLKIRSQE | >10 | ~3 | n.d. | >10 |
| 4-TLF20 | TLFLAHGRLVYMFNVGHKKL | ~4 | ~3 | ~4 | >20 | |
| 4-END11 | ENDFMTLFLAH | >50 | >50 | >50 | >50 | |
| α5 | 5-GLG27 | GLGTRLRAQSRQRSRPGRWHKVSVRWE | ~2 | ~5 | ~2 | ~2 |
| 5-PGR12 | PGRWHKVSVRWE | ~3 | ~3 | >50 | >50 | |
Sequences of peptides are given in the single-letter code and are named with the number presenting the corresponding α chain and the first 3 amino acids followed by the total number of amino acids. Data are the mean ± SD of 3 independent experiments.
1
The inhibitory concentration which leads to at least 90% cell death in the CFU assay.