Skip to main content
. 2019 Nov 17;20(22):5783. doi: 10.3390/ijms20225783

Table 1.

Motifs information of potential phytohormone transporters in ABCG subfamily genes of nine Rosaceae species.

Motif Logo Sequence E-Value Sites Width
1 graphic file with name ijms-20-05783-i001.jpg VRGVSGGERKRVSIGNEJIINPSJLFLDEPTSGLDSTTALR 4.9 × 10−1822 60 41
2 graphic file with name ijms-20-05783-i002.jpg GFVTQDDVLFPHLTVEETLVFAALLRLPKTLSKEQKEKRVEEVISELGLE 1.1 × 10−1875 60 50
3 graphic file with name ijms-20-05783-i003.jpg EKTJLNGITGSVRPGEILALLGPSGSGKTTLLBALAGRLTQ 1.2 × 10−1524 60 41
4 graphic file with name ijms-20-05783-i004.jpg GKTVVTSIHQPSSRLFHLFDKLJLLSKGSLLYFGKASEAMV 1.5 × 10−1397 60 41
5 graphic file with name ijms-20-05783-i005.jpg WGFYPCFTALFTFPQERAMLTKERAAGMY 8.3 × 10−1056 59 29
6 graphic file with name ijms-20-05783-i006.jpg VKKIPVFIIWIRYLSFVYYTYRLLLKVQY 3.2 × 10−924 58 29
7 graphic file with name ijms-20-05783-i007.jpg WWZQFSILFQRGJKERRHEYFNWLRITQV 3.9 × 10−814 41 29
8 graphic file with name ijms-20-05783-i008.jpg QGLGLAIGATLMDLKRATTLASVTVLTFM 4.9 × 10−674 46 29
9 graphic file with name ijms-20-05783-i009.jpg RLSAYFLARTVVDLPLDLILPVAFLVITYWMAGLRPSAETF 2.3 × 10−1088 58 41
10 graphic file with name ijms-20-05783-i010.jpg GCSPLISMNPAEFLLDLANGN 5.6 × 10−528 54 21
11 graphic file with name ijms-20-05783-i011.jpg NGKPSPAVVHEYLVEAYETRVADEEKKKJMVPLPLDDELKLKVSISKREW 4.1 × 10−705 21 50
12 graphic file with name ijms-20-05783-i012.jpg KVSGSITYNGQTYSKFVKRRT 2.1 × 10−485 59 21
13 graphic file with name ijms-20-05783-i013.jpg ALJLGLLWWQSDSNN 1.9 × 10−350 58 15
14 graphic file with name ijms-20-05783-i014.jpg NNBPSPNSMVPTFANPFWIEMAVLAKRSMKNARRMPELFGI 3.9 × 10−318 15 41
15 graphic file with name ijms-20-05783-i015.jpg FGYRLLAYLALRRMK 5.3 × 10−276 54 15
16 graphic file with name ijms-20-05783-i016.jpg KPKFQTLPTLPJTLKFTDVTYKVILKGMR 1.8 × 10−520 48 29
17 graphic file with name ijms-20-05783-i017.jpg DEVPSGMALSRASSASLAFSFLFSGFTIP 4.9 × 10−498 40 29
18 graphic file with name ijms-20-05783-i018.jpg SSRELFRASPSRESLLMKRNSFIYKFKSAQL 1.0 × 10−390 26 31
19 graphic file with name ijms-20-05783-i019.jpg TGRTIVCTIHQPNIDIFEAFDELJLLKTGGRIIYSGPLGQHSSRVIEYFZ 2.9 × 10−479 14 50
20 graphic file with name ijms-20-05783-i020.jpg GISGGQKKRLTTAEMJIGPTKALFMDEITNGLDSSTAFQIVNSLQQLVHI 5.0 × 10−469 14 50