Skip to main content
. 2019 Nov 18;11(11):673. doi: 10.3390/toxins11110673

Table 1.

Mature peptides detected by LC-MS/MS analysis of native and reduced/alkylated venom samples. Masses shown are monoisotopic.

Amino Acid Sequence Precursor Putative Fold No. Cys Theoretical Native Mass (Da) Observed Native Mass (Da) Theoretical RAa Mass (Da) Observed RA Mass (Da)
DEKDCIARGQKCVGENKPCCKGTTCMYYANRCVGV U-RDTX b-Pr1a ICK c 6 3835.69 3835.62 4105.89 4105.81
TIEKSCKPGTTFKHKDGCNTCKCSDDGKNALCTSKLCL U-RDTX-Pr11a.2 Pacifastin 6 4070.88 4070.81 4341.09 4340.99
TMKQSCKPGATFKHKDGCNTCKCSDDGKSARCTARLCW U-RDTX-Pr10a.2 Pacifastin 6 4158.86 4158.78 4429.06 4428.96
EEHGCIPPFQPCEGVNSRCCGLYVCFNKICLATP U-RDTX-Pr2a ICK 6 3763.65 b 3763.59 d 4033.86 d 4033.77 b
SRACSKPGQTVLAPDGCNHCRCSEKGILMACTKMMCPPR U-RDTX-Pr11a.1 Pacifastin 6 4172.89 4172.82 4443.10 4442.99
HGCIPPFQPCEGVNSRCCGLYVCFNKICLATP U-RDTX-Pr2b ICK 6 3505.57 b 3505.51 d 3775.77 d 3775.68 b
GGCIQRYGKCSTENSNCCAPSECYFSFNQCF U-RDTX-Pr7a ICK 6 3439.33 3439.26 3709.53 3709.43
CIPAANPCRGNAKCCGNYVCKNGRCLPRS U-RDTX-Pr5a ICK 6 3061.39 3061.31 3331.59 3331.52
MMPVCFEGEKLNKDQTKCIKA U-RDTX-Pr9a Unknown 2 2410.16 2410.13 2500.23 2500.19
GEDVCIPSGQKCGPYMNMGCCKGLVCMSYAARCVSMGGIPR U-RDTX-Pr4a ICK 6 4264.84 4264.77 4535.05 4534.09
MDCKPGKKFKIDCNTCICSKEGKAAACTQKLCLK U-RDTX-Pr21.2 Pacifastin 6 3699.79 3699.72 3970.00 -
CRPGALTVAPDGCNMCTCLSNGKLGRCTHDLICPPR U-RDTX-Pr12a.1 Pacifastin 6 3765.73 - 4035.93 4035.85

Cysteine residues inferred by measured masses to form intrachain disulfide bonds are shown highlighted in grey. a RA, reduced and alkylated with 2-iodoethanol (addition of 45.034 Da per half-cystine). b RDTX, reduvitoxin. c ICK, inhibitor cystine knot. d Observed MS1 and MS2 spectra for Pr2a and Pr2b suggest that K28 of Pr2a (K26 of Pr2b) is carbamylated, but this assignation is putative.