Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
ODF1 MS/MS spectrum. In (a) the spectrum of the peptide sequence: ILASSCCSSNILGSVNVCGFEPDQVKVRVK, C6-Carbamidomethyl (57.021146 Da), C7-Carbamidomethyl (57.02146 Da), C18-Carbamidomethyl (57.02146 Da). In (b) the spectrum of the peptide sequence EFSLPPCVDEKDVTYSYGLGSCVK, C22-Carbamidomethyl (57.021146 Da).
