Figure 8.
Confirmation of putative receptor-binding sites on the ligands using synthetic analogues by immunocytochemistry. Interaction of synthetic analogues of putative receptor-binding sites with cultured hBMECs. The interaction was detected with streptavidin-FITC conjugate. Nuclei are stained with DAPI. rDIII and rNadA (positive control) – whole recombinant ligands were incubated with hBMECs. DIII-1 – GTTYGVCSK-biotin; DIII-2 – VLIELEPPFGDSYIVVGRK-biotin; NadA-1 – AATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQK-biotin; NadA-2 – LADTDAALADTDAALDETTNALNKLGENITTFAEETK-biotin. Negative control – synthetic peptides were excluded from the assay.