Table 2.
List of peptides which are showing more than five activities along with their PPepDB.
| PPepDB ID | Data source | Peptide name | Functions | Sequence | Length |
|---|---|---|---|---|---|
| PPepDB_1570 | CAMP, Cybase, EROP-Moscow | Cter L | Antimicrobial, Insecticidal, Hemolytic, Anthelmintic, Antibacterial, Cytotoxic | HEPCGESCVFIPCITTVVGCSCKNKVCYD | 29 |
| PPepDB_1571 | CAMP, Cybase, EROP-Moscow | Cter K | Antimicrobial, Insecticidal, Hemolytic, Anthelmintic, Antibacterial, Cytotoxic | HEPCGESCVFIPCITTVVGCSCKNKVCYN | 29 |
| PPepDB_1925 | Cybase, APD, CAMP, EROP-Moscow, LAMP, PhytAMP | Cyclotoviolacin O15 | Nematocide, Hemolytic, Antibacterial, Antifungal, Antiviral, Antiparasitic | GLVPCGETCFTGKCYTPGCSCSYPICKKN | 29 |
| PPepDB_1926 | Cybase, APD, CAMP, EROP-Moscow, LAMP, PhytAMP | Cycloviolacin O14 | Nematocide, Anti-HIV, Hemolytic, Enzymatic-degradation, Antibacterial, Antifungal, Antiviral, Anti-HIV, Antiparasitic | GSIPACGESCFKGKCYTPGCSCSKYPLCAKN | 31 |
| PPepDB_2070 | DBAASP, APD, Cybase, Literature | Cyclotide Cter M, Cyclotide cliotide T3 | Anticancer, Insecticidal, Hemolytic, Anthelmintic, Antibacterial, Cytotoxic | GLPTCGETCTLGTCYVPDCSCSWPICMKN | 29 |
| PPepDB_2096 | DBAASP, CAMP, APD, Cybase | Cyclotide cter-P, Cyclotide cliotide T4 | Anticancer, Insecticidal, Hemolytic, Anthelmintic, Antibacterial, Cytotoxic | GIPCGESCVFIPCITAAIGCSCKSKVCYRN | 30 |
| PPepDB_2104 | DBAASP, CAMP, Literature | Coccinin | Antiviral, Anticancer, Antifungal, Hemolytic, Antiproliferative, HIV-1-reverse-transcriptase-inhibition | KQTENLADTY | 10 |
| PPepDB_2126 | DBAASP, Cybase, CAMP, APD, Literature | Cliotide T1 | Antibacterial, Anticancer, Cytotoxic, Antimicrobial, Immunomodulatory, Nematocide, Hemolytic | GIPCGESCVFIPCITGAIGCSCKSKVCYRN | 30 |
| PPepDB_2160 | DBAASP, EROP-Moscow, CAMP, Cybase | Cter G | Antibacterial, Anticancer, Antifungal, Insecticidal, Hemolytic, Anthelmintic, Cytotoxic | GLPCGESCVFIPCITTVVGCSCKNKVCYNN | 30 |
| PPepDB_2170 | DBAASP, EROP-Moscow, Cybase, CAMP, APD | Tricyclon-A | Antibacterial, Anticancer, Antifungal, Antiviral, Hemolytic, Antimicrobial | GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN | 33 |
| PPepDB_2207 | DBAASP, PhytAMP, EROP-Moscow, Cybase, APD, Literature | Kalata B2 | Antibacterial, Anticancer, Antifungal, Nematocide, Molluscicidal, Insecticidal, Hemolytic, Antiviral, Antiparasitic | GLPVCGETCFGGTCNTPGCSCTWPICTRD | 29 |
| PPepDB_2211 | DBAASP, PhytAMP, EROP-Moscow, Cybase, CAMP, APD | Kalata B7 | Antibacterial, Anticancer, Antifungal, Nematocide, Molluscicidal, Antiparasitic, Hemolytic, Antimicrobial | GLPVCGETCTLGTCYTQGCTCSWPICKRN | 29 |
| PPepDB_2214 | DBAASP, PhytAMP, EROP-Moscow, Cybase, CAMP, APD | Kalata B1 | Antibacterial, Antifungal, Antiviral, Anticancer, Hemolytic, Cytotoxic, Nematocide, Molluscicidal, Insecticidal, Enzymatic-degradation, Anti-HIV, Enzyme-inhibitor | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 |
| PPepDB_2215 | DBAASP, PhytAMP, EROP-Moscow, Cybase, CAMP, APD | Circulin-B, CIRB | Antibacterial, Antifungal, Hemolytic, Cytotoxic, Antiviral, Insecticidal, Anti-HIV | GVIPCGESCVFIPCISTLLGCSCKNKVCYRN | 31 |
| PPepDB_2226 | DBAASP, PhytAMP, LAMP, EROP-Moscow, Cybase, CAMP, APD, Literature | Cycloviolacin-O2 | Antibacterial, Anticancer, Antifungal, Cytotoxic, Nematocide, Hemolytic, Anti-barnacle, Antiparasitic, Antimicrobial | GIPCGESCVWIPCISSAIGCSCKSKVCYRN | 30 |
| PPepDB_3844 | Literature, EROP-Moscow, BIOPEP | Oryzatensin | Anti-analgesic, Anti-amnestic, Anticancer, Immunomodulatory, Neuropeptide, Opioid-antagonist | GYPMYPLPR | 9 |
| PPepDB_3859 | Literature, PhytAMP, EROP-Moscow, Cybase, CAMP, APD | Varv-A | Cytotoxic, Nematocide, Hemolytic, Anti-HIV, Anticancer, Antimicrobial | GLPVCGETCVGGTCNTPGCSCSWPVCTRN | 29 |
| PPepDB_3860 | Literature, PhytAMP, LAMP, EROP-Moscow, Cybase, CAMP, APD | Cyclovialacin O24 | Antibacterial, Antifungal, Antiviral, Nematocide, Anti-HIV, Hemolytic, Enzymatic-degradation | GLPTCGETCFGGTCNTPGCTCDPWPVCTHN | 30 |
| PPepDB_3992 | PhytAMP, LAMP, EROP-Moscow, CAMP, APD, Cybase | Cycloviolacin-O13 (Cyclotide c3) | Nematocide, Anti-HIV, Hemolytic, Enzymatic-degradation, Antibacterial, Antifungal, Antiviral, Antiparasitic | GIPCGESCVWIPCISAAIGCSCKSKVCYRN | 30 |
ID, source of data, peptide name, functions, sequence and sequence length.