Skip to main content
. 2020 Feb 14;30(2):314–328. doi: 10.1089/thy.2019.0598

Table 1.

Comparison of the C-Terminal Amino Acid Sequences of Wild-Type and Mutant Thyroid Hormone Receptor α Generated Through CRISPR/CAS9-Mediated Targeted Mutagenesis

Protein C-terminal amino acid sequence
The thraa gene
 Wild-type TRα1L -FPPLFLEVFEDQEGSTGVAAQEDGSCLR*-428
 4-bp deletion
 ThraaPhe404Leufs*22
-FPPLLRSSRIRREALEWQHRKTVPA*-425
 8-bp insertion
 ThraaLeu405Glufs*6
-FPPLFEDQEV*-410
 Wild-type TRα1S -FPPLFLEVFEDQEV*-414
 4-bp deletion
 ThraaPhe404Leufs*10
-FPPLLRSSRIRRC*-412
 8-bp insertion
 ThraaLeu405Glufs*6
-FPPLFEDQEV*-410
The thrab gene
 Wild-type TRαB -HASRFLHMKVECPTELFPPLFLEVFEDQDV*-409
 4-bp deletion
 ThrabThr393Profs*31
-HASRFLHMKVECPPSFPHFSWRSSRIRTCDVPANCGKRIRNVS*-422
 1-bp insertion
 ThrabGlu394*
-HASRFLHMKVECPT*-394

bp, base pair.