Table 2.
List of peptides obtained by digestion with trypsin and LC-MS/MS analysis.
Domain | Tryptic peptide | m/z (1+) | MC | PSMs | CAM | Highest probability (%) |
---|---|---|---|---|---|---|
N-term | VTSKSLCTPGCK | 1,207.58 | 1 | 342 | 145 | 100 |
N-term | VTSKSLCTPGCKTGILMTCAIK | 2,162.09 | 2 | 6 | 2 | 7 |
Core | TGILMTCAIK | 1,029.54 | 0 | 37 | 0 | — |
Core | SLSLCTPGCKTGILMTCAIK | 1,820.91 | 1 | 4 | 0 | — |
Full | VTSKSLCTPGCKTGILMTCAIKTATCGCHFG | 3,003.39 | 3 | 17 | 1 | 23 |
C-term | TGILMTCAIKTATCGCHFG | 1,984.88 | 1 | 144 | 70 | 100 |
C-term | TATCGCHFG | 916.3329 | 0 | 91 | 52 | 100 |
MC: Missed cleavage. PSMs: Peptide Spectra Match.