Skip to main content
. 2020 Mar 13;9:e47946. doi: 10.7554/eLife.47946

Table 2. Overview of peptides used in the fluorescence experiments.

Peptide Variant Sequence
Buforin II WT TRSSRAGLQFPVGRVHRLLRK
P11L TRSSRAGLQFLVGRVHRLLRK
P11A TRSSRAGLQFAVGRVHRLLRK
P11G TRSSRAGLQFGVGRVHRLLRK
LL-37 WT [LL-37, 37 aa]
G14L LLGDFFRKSKEKILKEFKRIVQRIKDFLRNLVPRTES

Positions of the substituted residues are highlighted in bold.