Skip to main content
. 2020 Mar 3;1862(8):183246. doi: 10.1016/j.bbamem.2020.183246

Table 3.

Amino acid sequences of P. chrysogenum AMPs and AMP variants and their physicochemical properties analyzed in silico.§

Proteins and variants MW$
[Da]		 pI Net charge
at pH 7		 GRAVY* No. positively charged aa References
PAF wt 6250.05 8.93 +4.7 −1.375 13 [17]
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
PAFopt 6290.20 9.30 +7.7 −1.438 15 [14]
Image 5
PAFD19S 6222.03 9.09 +5.7 −1.325 13 [38]
Image 6
PAFD53SD55S 6194.02 9.22 +6.7 −1.276 13 [39]
Image 7
PAFY48Q 6215.00 8.95 +4.7 −1.415 13 [9]
Image 8
PAFF31N 6216.97 8.93 +4.7 −1.489 13 [9]
Image 9
PAFK9A 6192.95 8.77 +3.7 −1.271 12 [34]
Image 10
PAFK35A 6192.95 8.77 +3.7 −1.271 12 [34]
Image 11
PAFK38A 6192.95 8.77 +3.7 −1.271 12 [34]
Image 12
PAFB wt 6500.32 8.83 +5.2 −1.031 16 [11]
LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
PAFBopt 6546.52 9.51 +9.9 −1.236 19 This study
Image 13
§

ExPASy ProtParam tool [26].

$

MW: Molecular Weight.

GRAVY: Grand Average of Hydropathy.

Protein Calculator v3.4 (The Scripps Research Institute; http://protcalc.sourceforge.net/) was applied for calculation of physicochemical properties. Red letters indicate aa exchanges.