Table 1.

Significantly changed titin phosphosites (–log 10 p-value KO/WT > 1.3).

Position within titin	UniProt identifyer	Log2 ratio (KO/WT)	–Log 10 p-value KO/WT	Charge	Multiplicity	Localization probability	Classification of phosphosite	Sequence window
S33880	A2ASS6	−0.659036	1.33033	3	1	1	Class 1	DLYYYRRRRRSLGDMSDEELLLPIDDYLAMK
S264	A2ASS6	0.419615	1.33152	2	2	1	Class 1	PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ
S315	A2ASS6	0.40279	1.45166	2	1	0.997856	Class 1	PSPVRSVSPAGRISTSPIRSVKSPLLIRKTQ
S16544	A2ASS6	−0.489219	1.48858	3	1	0.993809	Class 1	AEEEEPFSLPLTERLSINNSKQGESQLRIRD
S20332	A2ASS6	−0.239112	1.58029	2	1	1	Class 1	IIGYVVEMRPKIADASPDEGWKRCNAAAQLI
S264	A2ASS6	0.767076	2.14935	2	3	1	Class 1	PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ
T266	A2ASS6	0.767076	2.14935	2	3	1	Class 1	KTPPRIPPKPKSRSPTPPSIAAKAQLARQQS
S262	A2ASS6	0.720452	2.29218	2	3	1	Class 1	QLPHKTPPRIPPKPKSRSPTPPSIAAKAQLA
S322	A2ASS6	0.325277	3.06343	2	1	1	Class 1	SPAGRISTSPIRSVKSPLLIRKTQTTTMATG
S307	A2ASS6	0.509144	3.60898	2	2	1	Class 1	VRHVRAPTPSPVRSVSPAGRISTSPIRSVKS

$\text{Z-disk.}$

A-band.

$\text{M-band.}$

Multiplicity contains information about the phosphorylation of the peptides (single. double. triply phosphorylated).