Skip to main content
. 2020 Apr 23;10(4):652. doi: 10.3390/biom10040652

Table 1.

Some of the known antibiofilm peptides. Peptide name, sequence, and source are reported.

Peptide Sequence Source Reference
Protegrin 1 RGGRLCYCRRRFCVCVGR leukocytes; Pig, Sus scrofa [82]
Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL skin mucous secretions, Winter flounder, Pleuronectes americanus [83]
LL-37 [LL-37, 37 aa] neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; Homo sapiens; Also Pan troglodytes [84]
Indolicidin ILPWKWPWWPWRR bovine neutrophils, Bos taurus [85]
SMAP-29 RGLRRLGRKIAHGVKKYGPTVLRIIRIAG sheep leukocytes; Ovis aries [86]
Human β defensin 3 GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK skin, tonsils, oral/saliva, Homo sapiens [87]