Table 1.
Carbonylation of spectrin alpha and beta chains from RBC plasma membranes isolated from mice 24 h post-halogen exposure. Six putative carbonylation sites were confirmed by high resolution tandem mass spectrometry within spectrin alpha chain, and one site was identified within spectrin beta chain post-bromine exposure. These sites were all confirmed with a number of high confidence filters that included A-score and localization probabilities as indicated within the table, and further explained in detail within the methods section. The representative chromatography along with the MS1 & MS2 spectra are further highlighted in Fig. 4.
| Spectrin Alpha Chain, Erythocytic Protein (P08032): | |||||||
|---|---|---|---|---|---|---|---|
| Peptide Carbonylation Modification Site/Sequence |
Tx | Localization Probability |
A-score | Peptide Probability |
Xcorr | m/z | Δppm |
| (K640) QQDFEEELAVNEIMLNNLEK | Cl2 | 100% | 1000 | 97% | 4.1 | 3 | −3.5 |
| (K1401) GKCDQVESWMVAR | Br2 | 100% | 1000 | 99% | 2.7 | 3 | −0.6 |
| (K1484) ALKEQLLTELGK | Br2 | 100% | 152 | 97% | 2.7 | 2 | −0.0 |
| (K1706) MNGVNERFENVQSLAAAHHEK | Cl2 | 100% | 1000 | 99% | 3.7 | 3 | −2.9 |
| (K1988) LSEIAELKDQLVAGEHSQAK* | Br2 | 100% | 165 | 100% | 5.5 | 3 | −1.7 |
| (K2259) MQHNLEQQIQAKDTIGVSEETLKEFSTTYK | Br2 | 100% | 25 | 96% | 3.3 | 5 | −7.1 |
| Spectrin Beta Chain, Erythocytic Protein (P15508): | |||||||
| Peptide Modification Site/Sequence |
Tx |
Localization Probability |
A-score |
Peptide Probability |
Xcorr |
m/z |
Δppm |
| (K960) VNNYCVDCEETSKWIMDK | Br2 | 100% | 88 | 100% | 4.6 | 2 | 8.0 |