Table 4. Substrate candidates with qualitative changes in glycosylation level before and after GALNT6 silencing in MDA-MB-231 cells.

Protein name	m/z	Charge	Precurcor m/z	pep_ score	Sequence	Glycan	Position in peptide	Position in protein
Alpha-2-HS-glycoprotein	719.823	4	2875.2629	23.64	LDGKFSVVYAKCDSSPDSAEDVRK	HexNAc (S)	S18	S138
Hornerin	1128.2667	4	4509.0378	11.19	MPKLLQGVITVIDVFYQYATQHGEYDTLNKAELK	Hex1HexNAc1 (T); HexNAc (T)	T10; T27	T10;T27
Alpha-2-macroglobulin	503.6593	5	2513.2603	11.08	MVSGFIPLKPTVKMLER	Hex1HexNAc1 (S); HexNAc (T)	S3; T11	S1387; T1395
CBFA2T2	853.4017	3	2557.1832	20	SSPPTMPPLPPINPGGPR	Hex1HexNAc1 (S); Hex1HexNAc1 (T)	S2;T5	S44; S47

m/z, mass-to-charge ratio.