Table 1.
Streptococcus-specific peptides, corresponding to virulence factors, identified in the Streptococcus spp. strains analyzed.
| Function | Strain | Protein | Peptide | Identity by BLASTP |
|---|---|---|---|---|
| Toxins | ST1 | Toxin RelE | LLATISM*IQEQGVLIAQRM*EWVKK | Streptococcus suis |
| ST3 | Antitoxin RelB | VFKENNLNTAQALNLFLKNVAETGQLNLK | Streptococcus gallolyticus | |
| ST12 | Antitoxin YefM | NTYLSQKVLRGM*AK | Streptococcus suis | |
| ST2 | Toxin YoeB | LIYM*M*DGDNVAFLSFKDHY | Streptococcus mitis | |
| ST11 and ST12 | Pyrogenic exotoxin SpeK | NIYAPRYDEDEILDNR | Streptococcus dysgalactiae subsp. dysgalactiae, Streptococcus dysgalactiae | |
| ST9 | Doc toxin | LYPTLFDKATILFVQLVKK | Streptococcus sobrinus Streptococcus downei | |
| Antibiotic resistance | ST3 | MarR family transcriptional regulator | M*DYQRINDYLTSIFNNVLVIEEM*SLRGSR | Streptococcus spp. |
| ST4 | MarR family transcriptional regulator | FNRFILAFEQLKK | Streptococcus oralis | |
| ST2 | MarR family transcriptional regulator | EM*QQYVDLQGAYLALVKEEFAKAGLLPLK | Streptococcus downei MFe28 | |
| ST9 | MurM protein | QSLQRYLSEFRGFLDK | Streptococcus equi | |
| ST8 | Beta-lactamase class A | FSITDVLVNSKKELVFQIDDK | Streptococcus suis | |
| ST6 | Beta-lactamase class A | LVPDQPIQITGFYVNEEEVPIFKLKNGQFVIADK | Streptococcus sanguinis | |
| ST3 | Cell wall-active antibiotics response protein | DTIHLERVILSNHDNVIILRK | Streptococcus pseudopneumoniae, Streptococcus sp. HMSC061D10, Streptococcus sp. SK140 | |
| ST10 | Streptomycin adenylyltransferase | M*RTETDM*FDVILQTAKVLQVDAVAM*SGSR | Streptococcus cristatus | |
| ST12 | Penicillin binding protein | VQESAQNAGDTIGRAVK | Streptococcus gallolyticus, Streptococcus macedonicus, Streptococcus pasteurianus | |
| ST14 | Glyoxalase/Bleomycin resistance protein | M*ITSLYPVLM*C*ENLEATANFFIENFQFR | Streptococcus sp. DD11 | |
| ST1 | M56 peptidase | FSHGQTAHETIVNAKDGKLVK | Streptococcus sanguinis | |
| Resistance to toxic substances |
ST4 | TelA protein | DSLQEFYFDSKSIEQKM*DGM*AAAVVK | Streptococcus iniae |
| ST1 | MerR family transcriptional regulator | LEDHLLDLKAK | Streptococcus agalactiae, Streptococcus halotolerans, Streptococcus thoraltensis, Streptococcus acidominimus | |
| Colonization and immune evasion | ST1 | N-acetylmuramoyl-L-alanine amidase | M*KKVILASTVALSILGFTQATVQAQENNAESVR | Streptococcus mitis |
| ST7 | N-acetylmuramoyl-L-alanine amidase | LVEIAFIDNNSDM*ATYEANK | Streptococcus dysgalactiae, Streptococcus urinalis, Streptococcus porcinus, Streptococcus agalactiae, Streptococcus pluranimalium, Streptococcus suis | |
| ST8 | Lysin | AGAIFVKREASHDYGHTGVVIK | Streptococcus phocae | |
| ST10 | Lysozyme | LIIFLLVFLFAFQTYR | Streptococcus henryi | |
| ST4 | Lysozyme M1 (1,4-beta-N-acetylmuramidase) | LNPM*IVVVFFLSFFALIFITGVTGNTVNK | Streptococcus suis | |
| ST3 | CLpX ATPases | EENDVDLQKSNILM*IGPTGSGKTFLAQTLAR | Streptococcus vestibularis | |
| ST5 | CLpX ATPases | SIIEETM*LDVM*FEVPSQENVKLIRITK | Streptococcus pneumoniae | |
| ST5 | CLp ATPases | WIGDAQKRTK | Streptococcus agalactiae, Streptococcus canis, Streptococcus equi, Streptococcus castoreus, Streptococcus dysgalactiae | |
| ST9 | CLp ATPases | RTIQDHIEDAITDYYLEHPK | Streptococcus cristatus, Streptococcus gordonii | |
| ST8 | CLp ATPases | ENLLQIVELM*LADVNKRLSSNNIHLDVTDK | Streptococcus pneumoniae, Streptococcus mitis | |
| ST8 | CLpC ATPases | EDVVKLIGNRATR | Streptococcus sinensis, Streptococcus anginosus | |
| ST14 | CLpX ATPases | NNPVLVGDAGVGKTVLALGLAQR | Streptococcus suis, Streptococcus pneumoniae | |
| ST3 | CLp ATPases | IM*VQPLIAHLAEKNISLK | Streptococcus macacae | |
| ST7 | CLp ATPases | ETIKAIHDLRKPK | Streptococcus castoreus, Streptococcus ictaluri | |
| ST6 | Neuraminidase A | SLVLPKLPGQVSLIGSNKQGVVDLNNK | Streptococcus sp. HMSC074B11, Streptococcus pseudopneumoniae, Streptococcus sp. HPH0090, Streptococcus sp. oral taxon 431, Streptococcus mitis, Streptococcus sp. UMB0029, Streptococcus sp. LQJ-218, Streptococcus infantis | |
| ST6 | Sialidase B | NAPYLGPGRGIIESSTGRILIPSYTGK | Streptococcus pneumoniae, Streptococcus mitis, Streptococcus pseudopneumoniae, Streptococcus infantis | |
| ST13 | Sialidase A | VPLVTSGDYSGSPINM*DM*ALVQDTSSKTK | Streptococcus agalactiae | |
| ST14 | Sialidase A | VPTLQLANGKTARFM*TQYDTK | Streptococcus pneumoniae, Streptococcus oralis | |
| ST3 | Sialidase A | EDVETNTSNGQRVDLSSELDKLK | Streptococcus pneumoniae | |
| ST10 | Choline binding protein (Cbp) | TGWVKDKGTWYYLDK | Streptococcus pneumoniae | |
| ST2 | Choline binding protein (Cbp) | EGSTWYYLKGSGAM*ATGWATANGQWSYFEK | Streptococcus mitis | |
| ST7 | PspA | TEQVLLTEAVQQVQR | Streptococcus gordonii, Streptococcus cristatus | |
| ST4 | PspA | DLDAADKALEAAQAELKAR | Streptococcus mitis | |
| ST4 | Ig A1 protease | GTESEAAKPAPKEAGTTAGNEVK | Streptococcus pneumoniae | |
| ST2 | Ig A1 protease | NNDKYYAIYNLK | Streptococcus sp. 596553, Streptococcus pneumoniae | |
| ST2 | Ig A1 protease | KKVM*GLLLIGSM*GQSLLLSIDAAALQNIELR | Streptococcus spp. | |
| ST13 | Sortase A | AKVGM*TIYLTDKSM*IYTYK | Streptococcus gallolyticus, Streptococcus macedonicus, Streptococcus pasteurianus, Streptococcus henryi | |
| ST2 | Sortase B | NFLIGQQSNHYQVSKVSKK | Streptococcus macedonicus, Streptococcus gallolyticus, Streptococcus pasteurianus, Streptococcus lutetiensis, | |
| ST4 | Sortase A | YYYEAAFLIIVPENTAFYK | Streptococcus azizi, Streptococcus acidominimus | |
| ST6 and ST13 | C5A peptidase | EDISGEEASAPQTSPQESPVEPEEVTRGR | Streptococcus suis | |
| ST2 | C5A peptidase | YPDKSPAEISELVKALIM*STAKPHINK | Streptococcus anginosus | |
| ST13 | M protein | LM*EERARHVDLIDNIR | Streptococcus pyogenes | |
| ST1 | M Protein | SVAVAVAVLGAAFANQTEVK | Streptococcus pyogenes | |
| ST1 | M Protein | AEAVSRSNSEQNNLEKR | Streptococcus pyogenes | |
| ST14 | M Protein | IVAVALTVVGAGFANQTEVK | Streptococcus pyogenes | |
| ST11 | M Protein | YVEKSYHLLSDFIDQISSTYNFKIDNK | Streptococcus cristatus | |
| ST9 | Mga protein | KVLLTFFLDKR | Streptococcus pseudoporcinus | |
| ST5 | O-acetylase OafA | IVPPLVM*M*ILLIIPFTFLVR | Streptococcus henryi | |
| ST10 | Superoxide dismutase | FGSGWAWLVVNPDGKLEVM*STANQDTPISEGK | Streptococcus anginosus, Streptococcus anginosus subsp. anginosus, Streptococcus constellatus subsp. constellatus, Streptococcus sp. 8400103 | |
| ST14 | Superoxide dismutase | FGSGWAWLVVNKDGKLEVTSTANQDTPLSEGK | Streptococcus infantarius, Streptococcus equinus | |
| ST6 | Peptidoglycane-N-acetylglucosamine deacetylase | DAELYQTYFAQK | Streptococcus oralis | |
| ST6 | CpsB | KGM*FETPEEKIAENFLQIR | Streptococcus pneumoniae | |
| ST1 | CpsC | EIILSQDVLEKVATDLKLELPPK | Streptococcus sp. 1643, Streptococcus oralis | |
| ST5 | CpsC | EIIISQDVLEEVVSDLKLDLTPK | Streptococcus pneumoniae | |
| ST13 | CapD protein | KLTDYVIDLVEILNK |
Streptococcus pneumoniae, mitis, Streptococcus pseudopneumoniae, Streptococcus oralis, Streptococcus australis, Streptococcus sp. M334 | |
| ST3 | Accessory pilus subunit | NNVKTYLLKIK | Streptococcus suis | |
| ST8 | Pilin protein FimC | SRFGDAADKAASLSAK | Streptococcus sanguinis | |
| ST12 | Agglutinin receptor | TVETIQSTNEQAVADYLTKKTK |
Streptococcus suis, Streptococcus agalactiae |
|
| ST3 | Agglutinin receptor | VESAVSLAKEAGLTVK | Streptococcus mitis | |
| ST7 | Agglutinin receptor | TIDPSVHQYGQQELDALVK | Streptococcus oralis, Streptococcus sp. CM6, Streptococcus sp. SR1 | |
| ST9 | Agglutinin receptor | TTSLM*FEDYLPAGYLFDLEKTLAENGDYEVTFDASK | Streptococcus canis FSL Z3-227 | |
| ST8 | adhesin P1/ Cell surface antigen I/II | ADYEAKLAKYQADLAK | Streptococcus mutans, Streptococcus intermedius, Streptococcus anginosus | |
| ST7 | CppA protein | NLFQGRENFIPK | Streptococcus anginosus | |
| ST9 | Transposase TcpC | TLEQFLDGYVSRYFTYDSQAGSSDENISK | Streptococcus pneumoniae, Streptococcus oralis, Streptococcus sp. HMSC056C01, Streptococcus sp. SK140, Streptococcus infantis SK1302 | |
| ST5 | LytR family transcriptional regulator | AHTVQIITEEASFNM*VQNLSNLENQYGETLM*R | Streptococcus oralis | |
| ST2 | Asp23 protein | SGLSGGFSAVQEKVGEGVEAVKDAASSNENTR | Streptococcus cristatus | |
| ST12 | Asp23protein | KM*TDLDVIEVNVKVVDIK | Streptococcus phocae, Streptococcus canis, Streptococcus ictaluri, Streptococcus pyogenes, Streptococcus dysgalactiae, Streptococcus dysgalactiae subsp. equisimilis, Streptococcus dysgalactiae subsp. dysgalactiae, Streptococcus dysgalactiae subsp. equisimilis SK1249 | |
| ST14 | Asp23 protein | ATEDGSIAVDVYTVLSYGTKISEVSKNIQER | Streptococcus infantis, Streptococcus oralis, Streptococcus mitis | |
| ST2 | Type VII secretion protein EsaA | NSDVSTALSNIWFEAIDSNLKK | Streptococcus oralis | |
| ST2 | Type VII secretion protein EssB | LRLALNLLDLEQALSLPVTFFLHPENLFITK | Streptococcus pantholopis | |
| ST8 | Type VII secretion protein EssB | LEFVREDNQISVQISSSGYRR | Streptococcus sp., Streptococcus mitis | |
| ST14 | Virulence factor | VFGQTDETTIPLLANALADSM*NQSELETLPR | Streptococcus macedonicus, Streptococcus equinus | |
| ST3 | Virulence-associated protein E | M*KATVDNYVLVLRNDPYISESLK | Streptococcus pasteurianus | |
| ST9 | Equibactin | LYEISLKVADC*LGKNGVK | Streptococcus equi | |
| Antimicrobial production | ST3 | Bacteriocin | WTSKSSKAYAYAGQTSYAFIK | Streptococcus salivarius |
| ST2 | Bacteriocin | M*SQKIGIM*M*NIK | Streptococcus intermedius | |
| ST14 | Bacteriocin-associated integral membrane protein | AIAVGFSLAGVLAILM*QK | Streptococcus pneumoniae | |
| ST4 | LanT protein | QNVDKLHFTRFDK | Streptococcus pneumoniae | |
| ST12 | LanM protein | RAATKFM*INTDC*PSK | Streptococcus pneumoniae | |
| ABC Transporters | ST2 | Metal ABC transporter | DGADYISVM*QDNLKALEK | Streptococcus varani |
| ST6 | Metal ABC transporter | VPSAYIWEINTEEEGTPDQISSLIEK | Streptococcus pyogenes, Streptococcus equi subsp. zooepidemicus Sz105, Streptococcus canis, Streptococcus castoreus, Streptococcus porcinus, Streptococcus ictaluri, Streptococcus equi | |
| ST10 | Copper ABC transporter | SM*PDAIYLFTLLKVAC*M*GLTSFYSLR | Streptococcus infantarius, Streptococcus lutetiensis, Streptococcus equinus, Streptococcus sp. CNU 77-61, Streptococcus sp. KCJ4932 | |
| ST1 | Copper ABC transporter | NNLTLYENQYSLPIAFASQSIYNNVK | Streptococcus mitis | |
| ST10 | Zinc ABC transporter | AVIARM*FASDPNIFVLDEPTTGM*DAGSK | Streptococcus spp. | |
| ST3 | Zinc ABC transporter | TIYKNFM*EIGTAILM*STGLAISLIVM*SKGK | Streptococcus cristatus, Streptococcus sp. HMSC062B01, Streptococcus gordonii, | |
| ST2 | Cobalt or another cation ABC transporter | DGKLREVFQIPSYEM*TQVASK | Streptococcus pneumoniae | |
| ST3 | Cobalt ABC transporter | LSSDPVEVTQYYIEKGGPNV | Streptococcus salivarius | |
| ST2 | Cobalt ABC transporter (CbiM) | IISKDPNSKTM*LALSGAFIFILSSLK | Streptococcus australis, Streptococcus parasanguinis | |
| ST4 | FeoABC transporter (FeoB) | LM*DM*GLTHHTKIYLRK | Streptococcus gallolyticus | |
| ST9 | FeoABC transporter (FeoB) | EATGNQNISPNLTISNAQLNLEDKNK | Streptococcus dysgalactiae | |
| ST1 | Bacitracin ABC transporter (BceAB) | TVLGFGC*FVVQLVVIILVAYANGYVM*K | Streptococcus sp. HSISM1, Streptococcus parasanguinis | |
| ST14 | Bacitracin ABC transporter (BceAB) | QNIIALIQENGIKKSVLAK | Streptococcus sp. SK643, Streptococcus pseudopneumoniae | |
| ST2 | Bacitracin ABC transporter | SVEYPEKIATLLVNAGYPPK | Streptococcus sanguinis | |
| ST9 and ST12 | Bacteriocin ABC transporter | VNKGEFIAIM*GESGSGK | Streptococcus phocae | |
| ST9 | Bacteriocin ABC transporter | M*IVNFYTPNHGQITLGDYDLK | Streptococcus gallolyticus | |
| ST4 | Bacteriocin ABC transporter | KTVEDLSM*M*KGDM*TFK | Streptococcus oralis, Streptococcus sp. NPS 308, Streptococcus sp. oral taxon 071 str. 73H25AP, Streptococcus mitis, Streptococcus sp. VT 162, Streptococcus australis, Streptococcus pseudopneumoniae, Streptococcus halitosis, Streptococcus spp. | |
| ST9 | Lantibiotic Mutacin ABC transporter protein (MutE) | LM*VPILNILPNGLPAGTDAVVAPK | Streptococcus sobrinus | |
| ST4 | Lantibiotic ABC transporter | STIM*KIIFGLENADSGAIVFNGGKNAGK | Streptococcus mitis | |
| ST14 | Amino acid ABC transporter | M*VDGKNQVVGADIGM*AQAIADELGVK | Streptococcus oralis | |
| ST3 | Amino acid ABC transporter | NLTDKSQM*NIGIFFAIIALVVIWFLM*KK | Streptococcus parasanguinis | |
| ST13 | Amino acid ABC transporter | TGVPLLTPSGTQDDLTVDAK | Streptococcus sp. 449_SSPC, Streptococcus salivarius | |
| ST14 | Amino acid ABC transporter | VIFM*DKGIIAEEGKPEDLFTNPKEER | Streptococcus sp. oral taxon 058, Streptococcus oralis | |
| ST13 | Amino acid ABC transporter | IVLPQAFRIALPNLTTALLNLM*R | Streptococcus sp. AS14, Streptococcus sanguinis, Streptococcus cristatus, Streptococcus sp. CCH8-C6 | |
| ST9, ST13 and ST14 | Amino acid ABC transporter | NLLLAPVKVQKR | Streptococcus sp. 45, Streptococcus infantarius, Streptococcus sp. KCJ4932 Streptococcus infantarius subsp. infantarius CJ18, Streptococcus lutetiensis 033, Streptococcus infantarius, Streptococcus equinus | |
| ST10 | Glutamine ABC transporter | DASLAPM*FVAGAIYLIM*IGLVTLISKQVEK | Streptococcus sp. DD13 | |
| ST13 | Glutamine ABC transporter | KDEVIKEAENLLER | Streptococcus sanguinis | |
| ST14 | Glycine/betaine ABC transporter | YDLQVLEDDKQLFPPYQGAPLM*KEDLLK | Streptococcus oralis, Streptococcus mitis | |
| ST2 | Glycine/betaine ABC transporter | QEITLAYVEWDSEVASTNVLAEVLKTK | Streptococcus infantarius | |
| ST4 | Glycine/betaine ABC transporter | AKLRTIVAAFAVM*VLGLGASYAPSM*IPSK | Streptococcus infantis | |
| ST14 | Oligopeptide ABC transporter | KNVQM*IFQDPQASLNAR | Streptococcus infantarius, Streptococcus lutetiensis | |
| ST1 | Multidrug ABC transporter | QLQQYIYESLLTTSVK | Streptococcus suis | |
| ST4 | Multidrug ABC transporter | SGSKALKQLQQYIYESLLTTSVK | Streptococcus suis | |
| ST10 | Multidrug ABC transporter | LESKEIDENSIVSK | Streptococcus pneumoniae, Streptococcus salivarius, Streptococcus sp. HMSC068F04, Streptococcus sp. FDAARGOS_192, Streptococcus sp. SR4, thermophilus, Streptococcus sp. C150, Streptococcus sp. HMSC064H09, Streptococcus sp. HMSC064H03, Streptococcus sp. HSISS2 | |
| ST2 | Multidrug ABC transporter | AQGTLADLQATFGDASASLNDIYLALTKEV | Streptococcus phocae | |
| ST1 | Multidrug ABC transporter | YLLNLDEKQINIAPHLTINHLK | Streptococcus | |
| ST1 | Multidrug ABC transporter | M*PTAFYLFFSSM*YQDTPGGPANFM*R | Streptococcus pneumoniae | |
| ST5 | Multidrug ABC transporter | TTLIM*VSQRTNSLAK | Streptococcus sp. ‘caviae’ | |
| ST7 | Multidrug ABC transporter | FPNAFYLSM*SILLVQAVLNM*R | Streptococcus pantholopis | |
| ST3 | Multidrug ABC transporter | SGVVLSLLGAM*ISFILYLVFLKANIK | Streptococcus sp. HMSC066E07, Streptococcus anginosus | |
| Multidrug ABC transporter | IAYLPQEGALFHDTVLYNLTIGREVPEDR | Streptococcus suis | ||
| ST14 | Macrolide ABC transporter (MacB) | STLM*NIIGM*LDRPTSGEYYLEGEEVAKLSEK | Streptococcus anginosus, Streptococcus sp. KCOM 2412, Streptococcus sp. HMSC057E02 | |
| Other Transporters | ST2 | Manganese transport protein MntH | YLLLSVVLISSLIAM*QLQQM*AGKLGIVTQK | Streptococcus equinus, Streptococcus sp. KCJ4950 |
| ST6 | HlyC/CorC family transporter | TAPVIIFLGKIVSPFVWLLSASTNLLSQM*TPM*K | Streptococcus cristatus, Streptococcus sp. marseille-P644, Streptococcus sp. marseille-P7375 | |
| ST9 | Multidrug transporter MatE | AM*LIM*SLGAGINIVLDPVLM*IM*FK | Streptococcus intermedius, Streptococcus sp. AS20 | |
| ST14 | MFS Lantibiotic transporter | DLWC*NM*IIAAK | Streptococcus dysgalactiae |
(M* methionine oxidation; C* carbamidomethylation of Cys).