TABLE 1.

Linear epitopes mapped to hantavirus glycoproteins from previously isolated monoclonal antibodies or human sera from convalescent survivors of infection

Species	Method	Target	MAb/serum	Neutralizing activity?	Residues	Amino acid sequence	Reference(s)
PUUV (strain Sotkamo)	Phage display peptide library	Gn	5A2	Yes	61–72, 264–280	SLKLESSCNFDL, EPLYVPTLDDYRSAEVL	33, 34
		Gc	1C9	Yes	822–834	EQTCKTVDSNDCL
		Gc	4G2	Yes	904–921	KCAFATTPVCQFDGNTIS
PUUV (strain Sotkamo)	Phage display peptide library	Gn	Human serum	Not tested	22–30	VNAKNLNEL	34
		Gn		Not tested	61–72	SLKLESSCNFDL
		Gn		Not tested	82–96	FTKWTWETKGDLAEN
		Gn		Not tested	442–453	TVYCNGVKKVIL
		Gc		Not tested	946–966	SALEWIDLDSSLRDHINVIVS
SNV (isolate 3H226)	Western blotting of truncated proteins	Gn	Human serum	Not tested	59–89	LKIESSCNFDLHVPATTTQKYNQVDWTKKSS	36
HTNV (strain 76-118)	Peptide scan	Gc	M7, Y1, Y5, Y7, Y22	Yes	916–924, 954–963	KVMATIDSF, LVTKDIDFD	40
ANDV (strain CHI-7913)	Peptide scan	Gn	Human serum	Yes	14–26	TLTLAMPKTTYEL	32
	Peptide scan	Gc		Yes	955–967	NLVLNRDVSFQDL
	Peptide scan	Gc		Yes	691–703	RKLTNPANKEES