Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
| NLS | Sequence | KD (µM) (Ref.) |
|---|---|---|
| ChREBP 158–190 | R158KPEAVVLEGNYWKRRIEVVMREYHKWRIYYKK190 | 3.03 ± 0.95 [5] |
| Nucleoplasmin | K155RPAATKKAGQAKKKK170 | 0.19 ± 0.02 [23] |
| SV40 | P126KKKRKV132 | 0.31 ± 0.15 [26] |
| AR | R617KCYEAGMTLGARKLKKL634 | 5 ± 0.1 [22] |
Key basic residues of NLS for the major binding site are presented in red. The KD value of ChREBP-NLS — importin α was determined with ITC measurement.
