. Author manuscript; available in PMC: 2021 Oct 1.

Published in final edited form as: Nanomedicine. 2020 Jun 12;29:102236. doi: 10.1016/j.nano.2020.102236

Table 1.

Characterization of α-CD99-A192 nanoworms

ELP	Amino acid sequence	M.W. (kDa)^b	T_t (°C)^c	R_h (nm)	R_g/R_h	Shape^e
A192	G(VPGAG)₁₉₂Y	73.6	59.9	7.5 ± 0.2	N/A	monomer
α-CD99- A192	αCD99^a- G(VPGAG)₁₉₂Y	99.2	45.3	46.6 ± 0.5	1.0^d	Extended rod- like shape

αCD99 amino acid sequence:

MAEVQLVESGGGLVRPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSHKRFDYWGQGTLVTVSRGGGGS GGGGSGGGGSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNN RPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSFPRTSSVVFGGGTKLTVLGLVPRGS

It is the expected molecular weight based on the amino acid sequence

Transition temperature was determined at the maximum first derivative of the optical density at 350 nm

This number represents R_g/R_h of peak 1 observed in SEC-MALS

The shape of α-CD99-A192 was determined by using the ratio R_g/R_h, which were obtained from DLS and SEC-MALS