Table 1.
Characterization of α-CD99-A192 nanoworms
| ELP | Amino acid sequence |
M.W. (kDa)b |
Tt (°C)c | Rh (nm) | Rg/Rh | Shapee |
|---|---|---|---|---|---|---|
| A192 | G(VPGAG)192Y | 73.6 | 59.9 | 7.5 ± 0.2 | N/A | monomer |
| α-CD99- A192 |
αCD99a- G(VPGAG)192Y |
99.2 | 45.3 | 46.6 ± 0.5 | 1.0d | Extended rod- like shape |
αCD99 amino acid sequence:
MAEVQLVESGGGLVRPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSHKRFDYWGQGTLVTVSRGGGGS GGGGSGGGGSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNN RPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSFPRTSSVVFGGGTKLTVLGLVPRGS
It is the expected molecular weight based on the amino acid sequence
Transition temperature was determined at the maximum first derivative of the optical density at 350 nm
This number represents Rg/Rh of peak 1 observed in SEC-MALS
The shape of α-CD99-A192 was determined by using the ratio Rg/Rh, which were obtained from DLS and SEC-MALS