Skip to main content
. 2020 Sep 24;9:e54573. doi: 10.7554/eLife.54573

Key resources table.

Reagent type
(species) or resource
Designation Source or reference Identifiers Additional information
Gene (Nematostella vectensis) vas1 GenBank AY730696
Gene (Nematostella vectensis) vas2 GenBank AY730697
Gene (Nematostella vectensis) piwi1 GenBank MF683122
Gene (Nematostella vectensis) piwi2 GenBank MF683123
Gene (Nematostella vectensis) tudor GenBank XM_032376221
Gene (Nematostella vectensis) twist GenBank AY286509
Gene (Nematostella vectensis) hh1 GenBank EU162651
Gene (Nematostella vectensis) ptc GenBank EU162650
Gene (Nematostella vectensis) gli GenBank EU162649
Gene (Nematostella vectensis) Anthox6a GenBank GQ240845
Gene (Nematostella vectensis) gbx GenBank DQ500757
Genetic reagent (Nematostella vectensis) hh11 This paper See Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis) hh12 This paper See Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis) hh13 This paper See Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis) ptc1 This paper See Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis) ptc2 This paper See Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis) ptc3 This paper See Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis) ptc4 This paper See Figure 10—figure supplement 1
Peptide, recombinant protein vas2 This paper MCFKCQQTGHFARECPNESAAGENGDRPKPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPHHHHHH
Antibody anti-vas2 (Rabbit polyclonal) This paper IF (1:1000), stock: 0.4 mg/mL
Antibody anti-α-Tubulin (mouse monoclonal) Sigma-Aldrich T9026 IF (1:1000)
Antibody anti-Phospho-Histone H3 (mouse monoclonal) Sigma-Aldrich 05–806 IF (1:1000)
Antibody anti-DIG-POD Fab fragments (Sheep polyclonal) Sigma-Aldrich 11207733910 FISH (1:1000)
Antibody anti-Fluorescein-POD Fab fragments (Sheep polyclonal) Sigma-Aldrich 11426346910 FISH (1:1000)
Chemical compound, drug GDC-0449 Cayman Chemical 13613 25 µM
Chemical compound, drug Cyclopamine Cayman Chemical 11321 5 µM
Chemical compound, drug Benzyl alcohol Sigma-Aldrich 305197
Chemical compound, drug Benzyl benzoate Sigma-Aldrich B6630
Commercial assay or kit Click-iT EdU Kit Thermo Fisher Scientific C10339
Commercial assay or kit TSA Plus Cyanine 3 System PerkinElmer NEL744001KT
Commercial assay or kit ImProm-II Reverse Transcription System Promega A3800
Commercial assay or kit T7 RNA polymerase Kit Promega P2077
Commercial assay or kit AmpliScribe T7-Flash Transcription Kit Lucigen ASF3507
Software, algorithm ImageJ ImageJ (http://imagej.nih.gov/ij/) RRID:SCR_003070
Software, algorithm Imaris Bitplane RRID:SCR_007370 8.3
Software, algorithm BoxPlotR BoxPlotR.shiny (https://github.com/VizWizard/BoxPlotR.shiny/blob/master/README.md) RRID:SCR_015629
Other Hoechst-34580 stain Sigma-Aldrich 63493 1 µg/mL
Other SYBR Green I stain Thermo Fisher Scientific S7567 1:5000
Other Phalloidin stain Thermo Fisher Scientific A12379 1:200
Other DIG RNA labeling mix Sigma-Aldrich 11277073910
Other Fluorescein RNA labeling mix Sigma-Aldrich 11685619910
Other Cas9 protein with NLS PNA Bio CP02 500 ng/µL