Table 2.
Recently Identified or Proposed AIPs
| Peptide Sequence | Type | Species | Identification Strategy | Ref |
|---|---|---|---|---|
| SKPDIVG | Mature |
Bacillus cereus Bacillus sp. strain S51107 |
Genetic analysis, standard comparison, HPLC, MS | 34,35 |
| FSLIEGFKRIa | Mature | Bacillus Licheniformis | Genetic analysis, HPLC, MS | 36 |
| SKPDI | Predicted Mature (Verified activity) |
Bacillus anthracis Bacillus thuringiensis (serovar thuringiensis, israelensis, and pondicheriensis) |
Genetic analysis, standard comparison | 37 |
| WKPDN | Predicted Mature |
Bacillus mycoides Bacillus pseudomycoides |
||
| SDIYG | Predicted Mature | Bacillus thuringiensis (serovar mycoides, kurstaki, huazhongen-sis, andsotto) | ||
| MRKLNNKVLMAVAAFATVFASVVATSACVWCSYQPEEPKCLRDKb | Propeptide (agrD) | Clostridium chauvoei | Genetic Analysis, qPCR, RNA expression | 38 |
| (CVLVTL)b | Mature | Clostridium acetobutylicum | Genetic Analysis, Knockout complementation. | 39 |
| AEPTWGW | Putative Mature (Verified Activity) | Clostridium acetobutylicum | Genetic Analysis, Knockout complementation, standard comparison | 40 |
| TSA(CLWFI) | Predicted Mature | Clostridium perfringens | Genetic Analysis, standard comparison | 41 |
| (CFMFV)b | Mature | Listeria monocytogenes | Genetic analysis, synthetic standards, co-culture complementation | 42 |
| DM(CNGYF) | Mature Slu-AIP-II | Staphylococcus lugdunensis | Genetic Analysis, Native Chemical Ligation (NCL) Trapping, HPLC, MS, standard comparison | 43 |
| KYPF(CIGYF) | Mature Ssc-AIP | Staphylococcus. schleiferi | ||
| KYNP(CLGFL) | Mature Ssi-AIP | Staphylococcus simulans | ||
| KINP(CTVFF) | Mature Shy-AIP | Staphylococcus hyicus | ||
| SINP(CTGFF) | Mature Sch-AIP | Staphylococcus chromogenes | ||
| YST(CDFIM) | Mature AIP-I | Staphylococcus argenteus | ||
| YST(CYFIM) | Mature AIP-IV | Staphylococcus schweitzeri | ||
| YSP(CTNFF) | Mature Swa-AIP | Staphylococcus warneri | ||
| VIRG(CTAFL) | Mature Svi-AIP | Staphylococcus vitulinus | ||
| TYST(CYGYF) | Mature Sho-AIP | Staphylococcus hominis | ||
| SFTP(CTTYF) | Mature Sha-AIP | Staphylococcus haemolyticus | ||
| DVGKADb | Minimal Mature | Streptococcus pneumoniae | Genetic analysis, knockout complementation, synthetic standards | 44 |
| IMDILIIVGG (10-mer) MDILIIVGG (9-mer) DILIIVGG (8-mer, most active) |
Mature SHP2 | Streptococcus pyogenes | Genetic analysis, HPLC, MS, standard comparison | 45 |
| AMDIIIIVGG (10-mer) MDIIIIVGG (9-mer) DIIIIVGG (8-mer, most active) IIIIVGG (7-mer) |
Mature SHP3 | Streptococcus pyogenes | ||
| DFLIVGPFDWLKKNHKPTK | Mature CSP | Streptococcus gallolyticus | Genetic analysis, HPLC, MS, standard comparison | 46 |
| IAILPYFAGCL | Mature ComS | Streptococcus thermophilus | Genetic analysis, HPLC, MS, standard comparison, overexpression | 16 |
a
Peptide has been isolated/identified from/in cell cultures but has unknown activity.
b
Peptide is proposed and has not been verified through isolation/identification from/in cell cultures. The actual native peptide may differ depending on how the propeptide is processed into the mature form.