Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
| FDR | LOG2(IAA/mock) | Positions within proteins | Gene names | Sequence window |
|---|---|---|---|---|
| 4.482 | 1.823 | 881;914 | AHA2;HA2 | YGKEEREAQWALAQRTLHGLQPKEAVNIFPE |
| 2.044 | 1.314 947;980 | AHA2;HA2 | VVKLKGLDIETPSHYTV____________ | |
| 1.603 | 0.593 | 931;964;931;670;930;807;913;976;931;936;670;932 | AHA2;HA2;AHA6;AHA8;HA9;AHA5;AHA9;AHA3 | IARLRELHTLKGHVESVVKLKGLDIETAGHY;IARLRELHTLKGHVESVVKLKGLDIETPSHY |
