Table 4.
Bacteriocin (reference) | Peptide | Relative molecular mass (Da) | Amino acid sequence (number of aa) | |
---|---|---|---|---|
Predicted from gene sequencea | Detected by MALDI/TOF-MS | |||
Aureocin 4181 (this work) | AurA | 2924.5 | 2951.5 ± 1.5 | fMGKLAIKAGKIIGGGIASALGWAAGEKAVGK (31)b |
AurB | 2797.3 | 2824.4 ± 1.5 | fMGAVAKFLGKAALGGAAGGATYAGLKKIFG (30)b | |
AurC | 2954.6 | 2983.6 ± 1.5 | fMGALIKTGAKIIGSGAAGGLGTYIGHKILGK (31)b | |
AurD1 | 3120.8 | 3147.7 ± 1.5 | fMGAVIKVGAKVIGWGAASGAGLYGLEKIFKK (31)b | |
Aureocin A70 [7] | AurA | 2924.5 | 2927.3 ± 1.5 | MGKLAIKAGKIIGGGIASALGWAAGEKAVGK (31)c |
AurB | 2797.3 | 2795.7 ± 1.5 | MGAVAKFLGKAALGGAAGGATYAGLKKIFG (30)c | |
AurC | 2954.6 | 2954.8 ± 1.5 | MGALIKTGAKIIGSGAAGGLGTYIGHKILGK (31)c | |
AurD | 3086.8 | 3087.7 ± 1.5 | MGAVIKVGAKVIGWGAASGAGLYGLEKILKK (31)c |
aa, amino acid
Da, daltons
f, formylation of the methionine residue
aPredicted Mr calculated by the ProtParam tool
bThe amino acid sequence determined for the aureocin 4181 peptides by MALDI/TOF/TOF mass spectrometry is shown in bold
cThe underlined amino acid sequences in the aureocin A70 peptides are also found in the structural peptides of aureocin 4181