Skip to main content
. 2021 Jan 12;23:100515. doi: 10.1016/j.imu.2021.100515

Table 6.

The best peptides according to their binding energy with SARS-COV-2 N protein.

peptide code peptide name microorganism sequence dock score (kcal/mol)
2KUY Bacteriocin glycocin F Lactobacillus Plantarum KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC −143.2 ± 7.1
1BRZ Defensin-like protein Pentadiplandra brazzeana DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY −122.4 ± 4.9
2MVI Bacteriocin plantaricin ASM1 Lactobacillus plantarum KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC −120.3 ± 5.5
2JPK Bacteriocin lactococcin-G subunit beta Lactococcus lactis subsp. lactis KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI −114.4 ± 2.5