Table 3.
Alignment of the deduced amino acid (aa) sequences of the PCR-amplified VP2 gene fragment (aa 407-440). The aligned sequences correspond to a CPV-2 vaccine strain (CPV-b, M38245), a CPV-2a (CPV-15, M24003), a CPV-2b (CPV-39, M74849), and a CPV-2c (56/00, FJ222821). Sequence from this study was deposited in GenBank with MT543040 accession number. Position 426 is highlighted in bold.
| Sequence | Amino acid position | ||
|---|---|---|---|
| GenBank accession number | 407 | 426 | 440 |
| CPV–2 (M38245) | GRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKT | ||
| CPV–2a (M24003) | .................................................N.................................. | ||
| CPV–2b (M74849) | .................................................D.................................. | ||
| CPV–2c (FJ222821) | .................................................E.................................. | ||
| BRA–UEL01 Cerdocyon thous (MT543040) | .................................................D.................................. | ||