Skip to main content
. 2020 Oct 23;52(1):449–453. doi: 10.1007/s42770-020-00389-9

Table 3.

Alignment of the deduced amino acid (aa) sequences of the PCR-amplified VP2 gene fragment (aa 407-440). The aligned sequences correspond to a CPV-2 vaccine strain (CPV-b, M38245), a CPV-2a (CPV-15, M24003), a CPV-2b (CPV-39, M74849), and a CPV-2c (56/00, FJ222821). Sequence from this study was deposited in GenBank with MT543040 accession number. Position 426 is highlighted in bold.

Sequence Amino acid position
GenBank accession number 407 426 440
CPV–2 (M38245) GRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKT
CPV–2a (M24003) .................................................N..................................
CPV–2b (M74849) .................................................D..................................
CPV–2c (FJ222821) .................................................E..................................
BRA–UEL01 Cerdocyon thous (MT543040) .................................................D..................................