Skip to main content
. 2021 Apr 9;27(3):1837–1847. doi: 10.1007/s10989-021-10214-y

Table 3.

Physicochemical properties, lipophilicity, water solubility, pharmacokinetics, druglikeness and medicinal chemistry friendliness of the eight potential trifunctional peptides as analyzed by using SwissADME

Parameters Peptides
PKRF PHYNN PNWKIN AIRAMPL PHWNIN TKHGGRINTL ERHHRGGRGRQS VEDKGMMHQQRMMEKAMNIPRMCGTMQRKCRMS
Physicochemical properties Number of heavy atoms 39 46 55 53 56 77 101 267
Number of aromatic heavy atoms 6 11 9 0 14 5 10 5
Fraction Csp3 0.58 0.43 0.56 0.76 0.47 0.67 0.56 0.70
Number of rotatable bonds 21 21 28 30 26 47 65 180
Number of H-bond acceptors 8 11 11 10 11 18 24 55
Number of H-bond donors 9 10 11 10 11 19 30 58
Molar refractivity 149.93 160.79 202.96 206.63 202.46 273.98 350.66 1001.83
TPSA (Å2) 224.55 300.82 322.82 316.33 325.48 525.37 789.00 1944.79
Lipophilicity Consensus log Po/w − 0.80 − 3.14 − 1.60 − 0.36 − 1.50 − 4.62 − 8.94 − 12.55
Water solubility Log S (ESOL) 0.33 0.79 − 0.45 − 0.59 − 0.71 1.14 3.98 2.50
Class (ESOL) Highly soluble Highly soluble Very soluble Very soluble Very soluble Highly soluble Highly soluble Highly soluble
Pharmacokinetics GI absorption Low Low Low Low Low Low Low Low
P-gp substrate No No Yes Yes Yes Yes Yes Yes
CYP1A2 inhibitor No No No No No No No No
CYP2C19 inhibitor No No No No No No No No
CYP2C9 inhibitor No No No No No No No No
CYP2D6 inhibitor No No No No No No No No
CYP3A4 inhibitor No No No No No No No No
Druglikeness Lipinski’s rule (number of violations) No (3) No (3) No (3) No (3) No (3) No (3) No (3) No (3)
Bioavailability score 0.17 0.17 0.17 0.17 0.17 0.17 0.17 0.17
Medicinal chemistry Leadlikeness (number of violations) No (2) No (2) No (2) No (2) No (2) No (2) No (2) No (2)
Synthetic accessibility 4.87 5.37 6.52 7.16 6.49 9.34 10.00 10.00

Fraction Csp3 ratio of sp3 hybridized carbons over the total carbon count of the molecule, H-bond hydrogen bond, TPSA topological polar surface area, log Po/w partition coefficient between n-octanol and water, ESOL estimated solubility, GI gastrointestinal, P-gp permeability glycroprotein, CYP1A2 cytochrome P450 1A2, CYP2C19 cytochrome P450 2C19, CYP2C9 cytochrome P450 2C9, CYP2D6 cytochrome P450 2D6, CYP3A4 cytochrome P450 3A4